Recombinant Full Length Canine Distemper Virus Hemagglutinin Glycoprotein(H) Protein, His-Tagged
Cat.No. : | RFL30058CF |
Product Overview : | Recombinant Full Length Canine distemper virus Hemagglutinin glycoprotein(H) Protein (Q66001) (1-607aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Canine distemper virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-607) |
Form : | Lyophilized powder |
AA Sequence : | MLSYQDKVGAFYKDNARANSSRLSLVTEDQGGRRPPYLLFVLLILLVGIMALLAITGVRF HQVSTSNMEFSRLLKEDMEKSEAVHHQVIDVLTPLFKIIGDEIGLRLPQKLNEIKQFILQ KTNFFNPNREFDFRDLHWCINPPSKIKVNFTNYCDTIGIRKSIASAANPILLSALSRSRG DIFPPYRCSGATTSVGSVFPLSVSLSMSLISRTSEIINMLTAISDGVYGKTYLLVPDYLE GEFDTQKIRVFEIGFIKRWLNNMPLLQTTNYMVLPENSKAKVCTIAVGELTLASLCVDES TVLLYHDSNGSQGGILVVTLGIFGATPMDQVEEVIPVPHPSVEKIHITNHRGFIKDSIAT WMVPALVSEKQEEQKNCLESACQRKSYPMCNQTSWEPFGGGQLPSYGRLTLPLDPSIDLQ LNISFTYGPVILNGDGMDYYESPLLDSGWLTIPPKNGTVLGLINKASRGDQFTVIPHVLT FAPRESSGNCYLPIQTSQIMDKDVLTESNLVVLPTQNFIYVIATYDISRGDHAIVYYVYD PIRTISYTHAFRLTTKGRPDFLRIECFVWDDDLWCHQFYRFEADSTNSTTSVENLVRIRF SCNRSKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | H |
Synonyms | H; Hemagglutinin glycoprotein |
UniProt ID | Q66001 |
◆ Recombinant Proteins | ||
LPAR2-5968HF | Recombinant Full Length Human LPAR2 Protein | +Inquiry |
RFL22706PF | Recombinant Full Length Prochlorococcus Marinus Atp Synthase Subunit B'(Atpg) Protein, His-Tagged | +Inquiry |
FxN-4373H | Recombinant Human FxN protein, His&Myc-tagged | +Inquiry |
Spike-1276V | Recombinant COVID-19 (BA. 2.12.1) Spike RBD protein(Arg319-Phe541), His-tagged | +Inquiry |
SLA2-2474H | Recombinant human SLA2, His-tagged | +Inquiry |
◆ Native Proteins | ||
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
Mucin-232P | Native Porcine Mucin | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
Chymotrypsin-163B | Active Native Bovine Chymotrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSC22D3-723HCL | Recombinant Human TSC22D3 293 Cell Lysate | +Inquiry |
GPI-5806HCL | Recombinant Human GPI 293 Cell Lysate | +Inquiry |
Skeletal Muscle-55H | Human Skeletal Muscle Tissue Lysate | +Inquiry |
FN3KRP-6176HCL | Recombinant Human FN3KRP 293 Cell Lysate | +Inquiry |
H2AFY2-5656HCL | Recombinant Human H2AFY2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All H Products
Required fields are marked with *
My Review for All H Products
Required fields are marked with *
0
Inquiry Basket