Recombinant Full Length Candida Glabrata Squalene Synthase(Erg9) Protein, His-Tagged
Cat.No. : | RFL11454CF |
Product Overview : | Recombinant Full Length Candida glabrata Squalene synthase(ERG9) Protein (Q9HGZ6) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYELLNLTSRSFAAVIMEL HPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSKLDTTDWSFDGNDLKEKDR VVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYILDENFNLNGVQTVKDYDKYCH YVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESMGLFLQKTNIIRDYAEDLDDGRSF WPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNALTHVIDVLTYLSSIHEQSSFQFCA IPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDLILNSRTLKGCVDIFQYYLRDMKQRLP VEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGVEPRETMIYLKVQERLKWDTQVIPRVQEE DYKFNMALSVVFCVLLSFYFFTK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG9 |
Synonyms | ERG9; CAGL0M07095g; Squalene synthase; SQS; SS; FPP:FPP farnesyltransferase; Farnesyl-diphosphate farnesyltransferase |
UniProt ID | Q9HGZ6 |
◆ Recombinant Proteins | ||
TBK1-337H | Recombinant Human TBK1 protein, His-tagged | +Inquiry |
TNFRSF10D-1641R | Recombinant Rhesus Monkey TNFRSF10D Protein | +Inquiry |
FGF23-28141TH | Recombinant Human FGF23, His-tagged | +Inquiry |
GM14477-6623M | Recombinant Mouse GM14477 Protein | +Inquiry |
KIF3C-374H | Recombinant Human KIF3C, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ADVag-281V | Active Native ADV Protein | +Inquiry |
APC-137 | Native Spirulina sp. Allophycocyanin protein | +Inquiry |
APOC1-27328TH | Native Human APOC1 protein | +Inquiry |
Collagen-225B | Native Bovine Type IV Collagen Protein | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANXA2-8833HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
ATRX-150HCL | Recombinant Human ATRX cell lysate | +Inquiry |
TCP10-1168HCL | Recombinant Human TCP10 293 Cell Lysate | +Inquiry |
TCEAL8-659HCL | Recombinant Human TCEAL8 lysate | +Inquiry |
Cerebellum-66R | Rhesus monkey Cerebellum (RT) Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERG9 Products
Required fields are marked with *
My Review for All ERG9 Products
Required fields are marked with *
0
Inquiry Basket