Recombinant Full Length Candida Glabrata Rhomboid Protein 2(Rbd2) Protein, His-Tagged
Cat.No. : | RFL19628CF |
Product Overview : | Recombinant Full Length Candida glabrata Rhomboid protein 2(RBD2) Protein (Q6FSG0) (1-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-266) |
Form : | Lyophilized powder |
AA Sequence : | MIAPQRMLMPEGRPPAGLTTGLLIFLTFLFGISQLYEDFKNHFVLTPNSLFDIDLGKLSL YPLMHLSYLHLVFNALAIVGPLNNFESSHGTIHTGVVLNLSAVIAGIIYCVVSRLLSLET GVAGASGWVFTFITYLCVKESQLYPRLELSRFIPGVTQSIPTQFTPVVFLLFTAIVFFQS SFLGHTAGMIVGYIMGYGETWFNILIPPAWIIEKIEEKADPLINLIPFGIKFYRSTEINT DDGYRSFFPGQEVLPTTTPGNVLGTA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RBD2 |
Synonyms | RBD2; CAGL0H00803g; Rhomboid protein 2 |
UniProt ID | Q6FSG0 |
◆ Recombinant Proteins | ||
CHCHD4-3371M | Recombinant Mouse CHCHD4 Protein | +Inquiry |
POLQ-23H | Recombinant Human POLQ Protein, GST-tagged | +Inquiry |
YWHAQ-4898H | Recombinant Human Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein, Theta Polypeptide | +Inquiry |
Arsa-654M | Recombinant Mouse Arsa Protein, MYC/DDK-tagged | +Inquiry |
CD5L-10965H | Recombinant Full Length Human CD5L, His-tagged | +Inquiry |
◆ Native Proteins | ||
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
LH-9389B | Active Native Bovine LH Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIAA0825-1099HCL | Recombinant Human KIAA0825 cell lysate | +Inquiry |
GJB2-293HCL | Recombinant Human GJB2 lysate | +Inquiry |
SMG9-94HCL | Recombinant Human SMG9 lysate | +Inquiry |
UNC45A-500HCL | Recombinant Human UNC45A 293 Cell Lysate | +Inquiry |
AKTIP-8926HCL | Recombinant Human AKTIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RBD2 Products
Required fields are marked with *
My Review for All RBD2 Products
Required fields are marked with *
0
Inquiry Basket