Recombinant Full Length Candida Glabrata Mitochondrial Inner Membrane Magnesium Transporter Mrs2(Mrs2) Protein, His-Tagged
Cat.No. : | RFL7683CF |
Product Overview : | Recombinant Full Length Candida glabrata Mitochondrial inner membrane magnesium transporter mrs2(MRS2) Protein (Q6FV22) (39-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (39-456) |
Form : | Lyophilized powder |
AA Sequence : | SPQGKKTIPLLNKPESSNVGAFPSAHQQLLSLKPITPNDSFISSTVFDSKGAIVAVSKKF QKWEFLRKHALYPRDLRKIDTSSVDIIPSIQVKPNNCIVLNMLHIKALIEKDRVYVFDTV DPSSAVKLGVLMYDLESKLSPKMGTQVQYYEHRALESILINIMSSLEAEFKLHYSICGQI LIDLENEVNRDKLRELLIKSKNLTLFYQKSLLIREVLDELLESDDDLASLYLTVKKTEED DFSDLEMLLETYYTQCDEYVQQAESLIQDIKSTEEIVNIILDANRNSLMLLELKITIYTL GFTVATLVPAFYGMNLKNFIEESYLGFGAVVVFSILSAYLVTRANFKALKSVTKLTMLKS SNPSQASYNMKTNSTLRPALARIRGLFKWRKNPDSNGQPIWNKQDRDVIWKWLMDEKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2 |
Synonyms | MRS2; CAGL0E05368g; Mitochondrial inner membrane magnesium transporter MRS2; RNA-splicing protein MRS2 |
UniProt ID | Q6FV22 |
◆ Recombinant Proteins | ||
YLQC-3997B | Recombinant Bacillus subtilis YLQC protein, His-tagged | +Inquiry |
GPR151-7153M | Recombinant Mouse GPR151 Protein | +Inquiry |
SLC46A1-5544R | Recombinant Rat SLC46A1 Protein | +Inquiry |
SSUH2RS1-4538Z | Recombinant Zebrafish SSUH2RS1 | +Inquiry |
Ace2-09R | Active Recombinant Rat Ace2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
IgG-020S | Native Sheep Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
PLG-30083TH | Native Human PLG | +Inquiry |
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARMC12-7977HCL | Recombinant Human C6orf81 293 Cell Lysate | +Inquiry |
LINGO1-4728HCL | Recombinant Human LINGO1 293 Cell Lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
MDM1-4406HCL | Recombinant Human MDM1 293 Cell Lysate | +Inquiry |
PPT1-001HCL | Recombinant Human PPT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2 Products
Required fields are marked with *
My Review for All MRS2 Products
Required fields are marked with *
0
Inquiry Basket