Recombinant Full Length Candida Albicans Mitochondrial Inner Membrane Magnesium Transporter Mrs2(Mrs2) Protein, His-Tagged
Cat.No. : | RFL18712CF |
Product Overview : | Recombinant Full Length Candida albicans Mitochondrial inner membrane magnesium transporter mrs2(MRS2) Protein (Q5A970) (34-468aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (34-468) |
Form : | Lyophilized powder |
AA Sequence : | KSNNVGSQDSKRTSKNSILHNLGSYSNSAESEILNKLKPITPNDLYVSCTSFDRIGNITA VSRKYPKMQFLKENHLFPRDLRKIDTSSIDVVPVIMIRPSSAILVNLLHIKAIIKKDNVM VFDTSKSEVATKLGIFMYDLELKLKSPANNVCYEFRALESILVSVTSYLEAEIKLHRQQC GIILAELEDEVDRAKLQELLIRSKKLSSFHQRAILIRDVLEELLENDEDLAGMYLTDLKR FEPEEENYEEIESILESYYNQCDEYVQQAGSLLSDIKATEEIVNIILDANRNSLMLFELK ITVYTLGFTVATLVPAFYGMNLKNYIEETNWGFGLVLVVSLLQGLAITWLNFRKLHKVQK LTMMGTSNSSKAGTGLSRHIPPTSRVDRWKRGSFLYRLFYGSGGKYSKPSKKFDRPTNRE KDAMWRMINDDKAMK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MRS2 |
Synonyms | MRS2; CAALFM_CR01960CA; CaO19.10128; CaO19.2597; Mitochondrial inner membrane magnesium transporter MRS2; RNA-splicing protein MRS2 |
UniProt ID | Q5A970 |
◆ Cell & Tissue Lysates | ||
MRS2-67HCL | Recombinant Full Length Human MRS2 overexpression lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MRS2 Products
Required fields are marked with *
My Review for All MRS2 Products
Required fields are marked with *
0
Inquiry Basket