Recombinant Full Length Candida Glabrata Dihydroorotate Dehydrogenase (Quinone), Mitochondrial(Ura9) Protein, His-Tagged
Cat.No. : | RFL12858CF |
Product Overview : | Recombinant Full Length Candida glabrata Dihydroorotate dehydrogenase (quinone), mitochondrial(URA9) Protein (Q6SZS5) (23-439aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (23-439) |
Form : | Lyophilized powder |
AA Sequence : | QVLKSSFMGLKPLQLTALLLAGSAGYLYFMNARSAIHEYVVCPVVRLITPDPENGHKLGI WCFKWGLSPKLYFDKDPESLHVNVFGTTMTNPIGCAAGLDKDAEAIDGIMPTGFGYMEVG SVTPVAQPGNPRPRFFRLPADDAVINRYGFNSSGHDVVYNNLMKRVNKFLNSYFGDKSID KLSLYKDKLLAVNLGKNKNGDEVKDYLKGVEKFQSLADVLVINVSSPNTPGLRDLQNEAK LTNLLSEIITKRDSQSNKPNALGKQNHKPPVLVKIAPDLTEPELQSIVEAAKKSKVDGII VSNTTIQRPNTLKTQDETLRNQVGGLSGKPLKPFALKAMKAVSKYAKDSDLVLVGCGGIS SGKDAIEFAKAGATFVQLYTSYAYVGPALIARIKDEVAEELKKEGKTWMEIIGEDNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | URA9 |
Synonyms | URA9; CAGL0M12881g; Dihydroorotate dehydrogenase; quinone, mitochondrial; DHOD; DHODase; DHOdehase; Dihydroorotate oxidase |
UniProt ID | Q6SZS5 |
◆ Recombinant Proteins | ||
Spike-804V | Active Recombinant COVID-19 (BA.2.3.20) Spike RBD protein, His-tagged | +Inquiry |
Crat-630R | Recombinant Rat Crat Protein, His-tagged | +Inquiry |
CFB-8924Z | Recombinant Zebrafish CFB | +Inquiry |
rep-1449A | Recombinant Avian infectious bronchitis virus rep protein, His-tagged | +Inquiry |
CNN3-416H | Recombinant Human CNN3 Protein (2-329 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
LOC780933-24B | Native Bovine Immobilized Anhydrotrypsin | +Inquiry |
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
TSH-1312B | Active Native Bovine TSH Protein | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
FTH1-28155TH | Native Human FTH1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPARCL1-745MCL | Recombinant Mouse SPARCL1 cell lysate | +Inquiry |
CMV-644HCL | Native Cytomegalovirus Lysate | +Inquiry |
EMP3-6605HCL | Recombinant Human EMP3 293 Cell Lysate | +Inquiry |
BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All URA9 Products
Required fields are marked with *
My Review for All URA9 Products
Required fields are marked with *
0
Inquiry Basket