Recombinant Full Length Candida Glabrata Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL10023CF |
Product Overview : | Recombinant Full Length Candida glabrata Autophagy-related protein 32(ATG32) Protein (Q6FRR4) (1-492aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-492) |
Form : | Lyophilized powder |
AA Sequence : | MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQMEGSEVPSESGVLGESW QQIRESDVGDGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQQLLGGQQEYKNFHMTAEE QLQEQAQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVDKGSCSSSLDEHELNSIFTSD SMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRLSKRFHQDIPREYRQYFHISQSS DPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKND AITLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRR KKHGGKPSTNYSKWITWGISLTIGVSIGYYATYMITTTLLYGKAESHHANEAKGFSITNG NSGSSSISHSTEYYESTISQKGLLRNTIVFIKRTIHNLNGKVGTFFASITQVIKQTPVRE DNQFYTLGYMLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; CAGL0H06545g; Autophagy-related protein 32 |
UniProt ID | Q6FRR4 |
◆ Recombinant Proteins | ||
SLC37A4-31417TH | Recombinant Human SLC37A4 | +Inquiry |
RFL35580PF | Recombinant Full Length Pseudomonas Fluorescens Probable Intracellular Septation Protein A(Pfl01_1486) Protein, His-Tagged | +Inquiry |
PRAC-368H | Recombinant Human PRAC, His-tagged | +Inquiry |
XKR5-10224M | Recombinant Mouse XKR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOC-7588M | Recombinant Mouse RHOC Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Tf-392R | Native Rat Transferrin | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
DIP-25 | Active Native NADPH dehydrogenase | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNX1-1605HCL | Recombinant Human SNX1 293 Cell Lysate | +Inquiry |
Testis-66H | Human Testis Tissue Lysate | +Inquiry |
MCCC2-4428HCL | Recombinant Human MCCC2 293 Cell Lysate | +Inquiry |
MORF4-4253HCL | Recombinant Human MORF4 293 Cell Lysate | +Inquiry |
TEKT4P2-4703HCL | Recombinant Human LOC100132288 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket