Recombinant Full Length Pseudomonas Fluorescens Probable Intracellular Septation Protein A(Pfl01_1486) Protein, His-Tagged
Cat.No. : | RFL35580PF |
Product Overview : | Recombinant Full Length Pseudomonas fluorescens Probable intracellular septation protein A(Pfl01_1486) Protein (Q3KG77) (1-198aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas fluorescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-198) |
Form : | Lyophilized powder |
AA Sequence : | MKQFIDFIPLLLFFIVYKLDPRTVDVAGHELTVGGIYSATAMLIISSLVVYGALFIKQRK LEKSQWLTLIACLVFGSLTLAFHSETFLKWKAPVVNWLFALAFIGSHFIGDRLLIKRIMG HALTLPDPVWTRLNIAWIAFFLFCGAANLFVAFTFQSIWVDFKVFGSLGMTVLFLVGQGI YLSRHLHDADTTTPKTED |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pfl01_1486 |
Synonyms | yciB; Pfl01_1486; Inner membrane-spanning protein YciB |
UniProt ID | Q3KG77 |
◆ Recombinant Proteins | ||
COX6C-3821M | Recombinant Mouse COX6C Protein | +Inquiry |
Taf13-6277M | Recombinant Mouse Taf13 Protein, Myc/DDK-tagged | +Inquiry |
tra-2-0999C | Recombinant C. elegans tra-2 Protein (IIe32-Gln445), N-His tagged | +Inquiry |
RSPH6A-1955H | Recombinant Human RSPH6A Protein, MYC/DDK-tagged | +Inquiry |
THAP11-12326Z | Recombinant Zebrafish THAP11 | +Inquiry |
◆ Native Proteins | ||
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
VTN-2H | Native Human monomeric vitronectin, Biotin labeled | +Inquiry |
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
Troponin C-085B | Native Bovine Troponin C Protein, Sepharose CL 4B attached | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPBP-1616RCL | Recombinant Rat PPBP cell lysate | +Inquiry |
HSPA8-5353HCL | Recombinant Human HSPA8 293 Cell Lysate | +Inquiry |
SCRN1-2021HCL | Recombinant Human SCRN1 293 Cell Lysate | +Inquiry |
SLC45A2-1634HCL | Recombinant Human SLC45A2 cell lysate | +Inquiry |
TCEB2-1187HCL | Recombinant Human TCEB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pfl01_1486 Products
Required fields are marked with *
My Review for All Pfl01_1486 Products
Required fields are marked with *
0
Inquiry Basket