Recombinant Full Length Candida Apicola Cytochrome P450 52E2(Cyp52E2) Protein, His-Tagged
Cat.No. : | RFL11280CF |
Product Overview : | Recombinant Full Length Candida apicola Cytochrome P450 52E2(CYP52E2) Protein (Q12573) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida apicola (Yeast) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MNINFSDALMLGGISLSFLLASQAIYFYFIYSPRAKKLGCAPPPIFFSFPLGIPDLIRLV NAWFHDDLLEWFTHRFEEFGRRTAFQSVAGQLWIGTIEPENIKTMLATSFKDYSLGFRYN AMYGLLGNGIFTLSGDGWKNSRALLRPQFSREQVSHLESMRTHINMMINNHFKGGQVVDA QVLYHNLTIDTATEFLFGESTNTLDPALAQQGLPGPKGLVTGEQFAEAFTSALELLSVRV MAGAAWFLVWTPKFWRSCKVCHNFIDYFVYKALATPMEKGQDADRYVFIRELTKETSDPR VIRDQALNILLAGRDTTAALLSFTTYYLGAYPEVYDELREAVIADFGSADAEPPTFEQLK QCKVLQNVIREVLRLHPNVPLNFREAIADTTFPTGGGPNGDQPIFVPKGQKVFYATYVMQ RNAGIWGPDSTSFRPDRWNEPREALASGWDYIPFNGGPRICLGQQFALTEASYTLVRICQ EFSRIEVLHPDVITARNVMKQRMRLPNSSSGGVITRFIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP52E2 |
Synonyms | CYP52E2; Cytochrome P450 52E2; CYPLIIE2 |
UniProt ID | Q12573 |
◆ Recombinant Proteins | ||
VIM-1086C | Recombinant Cynomolgus VIM Protein, His-tagged | +Inquiry |
HIV1 reversetranscriptase-01V | Recombinant HIV-1 Reverse Transcriptase, His-tagged | +Inquiry |
UCHL1-392H | Recombinant Human UCHL1 protein, His-tagged | +Inquiry |
HIST1H4B-2856R | Recombinant Rat HIST1H4B Protein | +Inquiry |
TFRC-1868P | Recombinant Pig TFRC protein(575-768aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
Vtn-694M | Native Mouse Vitronectin | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
IgG-349H | Native Horse Gamma Globulin Fraction | +Inquiry |
Thrombin-20H | Active Native Pig Thrombin | +Inquiry |
GPX1-8429H | Native Human GPX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUP62-1233HCL | Recombinant Human NUP62 cell lysate | +Inquiry |
HAS3-5632HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
SHPK-001HCL | Recombinant Human SHPK cell lysate | +Inquiry |
ALLC-63HCL | Recombinant Human ALLC cell lysate | +Inquiry |
CRYZ-408HCL | Recombinant Human CRYZ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CYP52E2 Products
Required fields are marked with *
My Review for All CYP52E2 Products
Required fields are marked with *
0
Inquiry Basket