Recombinant Full Length Candida Albicans Solute Carrier Family 25 Member 38 Homolog(Cao19.1804) Protein, His-Tagged
Cat.No. : | RFL15536CF |
Product Overview : | Recombinant Full Length Candida albicans Solute carrier family 25 member 38 homolog(CaO19.1804) Protein (Q59KC4) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MSSPPLSSPVPQVKTTQNGKSPDATVHLLAGAIAGLVSAVTLQPFDLLKTRLQQQQLTTK QEVRTTLTKELKKLTRVKDLWRGTLPSTLRTSIGAGLYFTTLSKMRTSWGEYKQSKDSSI NLKSNSSILPKLTAMENLTTGFIARGIVGYITMPITIIKTRFESNLYNYNSMYEGISGIY LDDKKQQQQIRNPSINKGVGGGGSWKNFFKGSVATLARDCPYAGLYVLTYEAFKNDLIPL IIPNSSLSLSSSSSLSSSSSLFVFNDNNRSSIINSTAAVLAASTCTTITAPFDAIKTRLQ LTNEEGGSMTTVLKKMLREDGGIKNLFRGLSLRLGRKGISAGISWCIYEELIKSNYFQSK FL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CAALFM_CR04920WA |
Synonyms | CAALFM_CR04920WA; CaO19.1804; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog |
UniProt ID | Q59KC4 |
◆ Recombinant Proteins | ||
SPAG11B-2872H | Recombinant Human SPAG11B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GC-2947H | Recombinant Human GC protein, His-tagged | +Inquiry |
GATA-3031S | Recombinant Staphylococcus epidermidis ATCC 12228 GATA protein, His-tagged | +Inquiry |
NAT13-1192H | Recombinant Human NAT13, GST-tagged | +Inquiry |
ADAMTS7-3008M | Recombinant Mouse ADAMTS7, His-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-8037H | Native Human Plasma APOB | +Inquiry |
Lactate dehydrogenase-039B | Active Native Bovine Lactate dehydrogenase Protein | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
CVB6-14 | Native Coxsackievirus B6 Antigen | +Inquiry |
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM1-1239RCL | Recombinant Rat CEACAM1 cell lysate | +Inquiry |
ECSIT-241HCL | Recombinant Human ECSIT lysate | +Inquiry |
TMEM223-962HCL | Recombinant Human TMEM223 293 Cell Lysate | +Inquiry |
EPAS1-6588HCL | Recombinant Human EPAS1 293 Cell Lysate | +Inquiry |
PARP1-710HCL | Recombinant Human PARP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAALFM_CR04920WA Products
Required fields are marked with *
My Review for All CAALFM_CR04920WA Products
Required fields are marked with *
0
Inquiry Basket