Recombinant Full Length Candida Albicans Ph-Response Regulator Protein Palh/Rim21(Rim21) Protein, His-Tagged
Cat.No. : | RFL3124CF |
Product Overview : | Recombinant Full Length Candida albicans pH-response regulator protein palH/RIM21(RIM21) Protein (Q59YK4) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MYWKNAWWVGTVYSSCEPIELPEGMLISKQYETYPITTVSKAIYKQMCYRNCIPVLNTNV GFVIDTFAKPLPIVSQSWREFTKDSLRGSFAYSVVSIIYAIAVSAVIIWFLTIFVLTNYT IKPSWLLKTSTILSTVYILVVVIKSILILHGQQRDGYLHGAKLLSELNDYNPIQIIDLIV VLLLQINQVQIIMRIFQRQKDKRMALLIGIVATLASQVIWAIAQFYTPADANEASDILPA FIYLVRIAMALCYAAIITVFFISKIQIILANKKIWLLTLLTFILIYSPVAFFVADVSNAF VYELSEIFSVVNYVIGVVIPWEWCNKFNLIMKAKEKEGVLGRRFYEDELYELDRFELFVE EQMPEDEDNGDTHSDSPGNELNGGAHHNSQEQSDRLIGSNSPTNKPHNGNNTDPTSRFRQ LLTNTKDAFLTLTDNIIAAGFAIPRSVSVSTQSLTGRYRNNSTARTEYTKEVVPDFSPEM FLQPEGSSHITETLSEQNAAPSTTNSNHRRRNVYVYSRKEVILDVSSDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RIM21 |
Synonyms | RIM21; CAALFM_C501950CA; CaO19.10686; CaO19.3176; pH-response regulator protein palH/RIM21 |
UniProt ID | Q59YK4 |
◆ Native Proteins | ||
Collagen Type I-10G | Native Goat Collagen Type I Protein | +Inquiry |
GABase-01P | Native Pseudomonas fluorescens γ-aminobutyric acid amino transferase, Tag Free | +Inquiry |
AK-14B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHPF-7526HCL | Recombinant Human CHPF 293 Cell Lysate | +Inquiry |
SCUBE2-2017HCL | Recombinant Human SCUBE2 293 Cell Lysate | +Inquiry |
GPKOW-734HCL | Recombinant Human GPKOW cell lysate | +Inquiry |
ESYT2-6534HCL | Recombinant Human ESYT2 293 Cell Lysate | +Inquiry |
BOLA1-173HCL | Recombinant Human BOLA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All RIM21 Products
Required fields are marked with *
My Review for All RIM21 Products
Required fields are marked with *
0
Inquiry Basket