Recombinant Full Length Candida Albicans Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL22566CF |
Product Overview : | Recombinant Full Length Candida albicans Palmitoyltransferase PFA4(PFA4) Protein (Q5AGV7) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MAVQLKWPILGVIIPCIIIFSLSYGSHYFILRHHLTMKQQLIYEFYVTMIWISYLLAIYT NPGRVPKNYKPSLASSTRIEQTEDDSDGLGLESREDETLIREEPISGDRCEWIRYCKKCN NYKPPRSHHCKICQQCVLQMDHHCPWTLNCVGNNNLPHFMRFLGWIIWGTGYLMIQLIKL IINYYENSNMPHYLFNKTELVAIIAITPLNFFVFASILVLFIRCLINICKGMTQIEIWEW ERLELQWSSKRLWRLIRFNYGRLHKGKPFPELNTWTNTTNNVNYNDNDDDGDEDVELINL ATNNNEDSTIVPQNFTIDDLIFPYNLGIWKNLVNALGYPYMWLIPFGKPKSNGYQPQISQ DYKQDDQLNLPWPPDGIRQKEIEINVLQQQGYQRDREEEDEEELRSIRNYQELRRRLDPR LNVQRSDFINDMGEGLTDFGVDEDSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA4 |
Synonyms | PFA4; CAALFM_C701480WA; CaJ7.0163; CaO19.13934; CaO19.6581; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q5AGV7 |
◆ Recombinant Proteins | ||
BLAZ-1932S | Recombinant Staphylococcus aureus (strain: EMRSA-3, other: HA-MRSA) BLAZ protein, His-tagged | +Inquiry |
FGF16-3227H | Recombinant Human FGF16 Protein (Full Length) | +Inquiry |
ZIC1-5827C | Recombinant Chicken ZIC1 | +Inquiry |
PLK2-565H | Recombinant Human Polo-like Kinase 2 (Drosophila), GST-tagged | +Inquiry |
YCDB-3153B | Recombinant Bacillus subtilis YCDB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Complement C3a-46H | Native Human Complement C3a | +Inquiry |
TTR-706H | Native Human Transthyretin | +Inquiry |
Lectin-1863W | Active Native Wheat Germ Agglutinin Protein | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
HSV1Ag-354H | Active Native Herpes Simplex Virus 1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAC1-3138HCL | Recombinant Human PLAC1 293 Cell Lysate | +Inquiry |
STX6-1373HCL | Recombinant Human STX6 293 Cell Lysate | +Inquiry |
BABAM1-8197HCL | Recombinant Human C19orf62 293 Cell Lysate | +Inquiry |
CCDC8-7747HCL | Recombinant Human CCDC8 293 Cell Lysate | +Inquiry |
UGT2A3-1879HCL | Recombinant Human UGT2A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA4 Products
Required fields are marked with *
My Review for All PFA4 Products
Required fields are marked with *
0
Inquiry Basket