Recombinant Full Length C4-Dicarboxylate Transport Sensor Protein Dctb(Dctb) Protein, His-Tagged
Cat.No. : | RFL18579RF |
Product Overview : | Recombinant Full Length C4-dicarboxylate transport sensor protein dctB(dctB) Protein (P10047) (1-622aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium leguminosarum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-622) |
Form : | Lyophilized powder |
AA Sequence : | MHKSAMSVSQKLWPSLPLQHRIRRMWWTYAALAFLAVVASLWTSGEIGQHRAEAALEEQA RMDVTLNAALLRTVLEKYRALPFVLSQDTALAAALVGNDAGTFERLSQKLEILAAGTKAA VIYVIDKDGIAVSASNWREPTSFVGNDYRFREYFQGAVERGQAEHFALGTVSKKPGLYIS QRISGSNGLLGVVVVKVEFDDVEADWNASGTPSYVVDERGIVLITSLPSWRFMTIGRIAE DRLTAIRESLQFGAAPLQPLPLDMVRNLGEGLDVVEIVMPGDAGKTRFLDVATSVPATGW HLQHLVALGPSVDAGIREARMLALLILLPLLAGAAFLLRRRHTIALRISSEQQAREELER RVVERTLDLSQARDRLQAEIIGHKSTEQKLQAVQQDLVQANRLAILGQVAAGVAHEINQP VATIRAYADNARTFLDRGQTAPAGENLESIAALTERIGSITEELKTFARKGRGSAEPTGL KDVIEGAVMLLRSRFAGRMDTLDIDLPPDELQVMGNRIRLEQVLINLLQNALEAVAPKAG EGRVEIRTSTDAGMVTVTVADNGPGIPTEIRKGLFTPFNTSKESGLGLGLVISKDIVGDY GGRMDVASDSGGTRFIVQLRKA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | dctB |
Synonyms | dctB; C4-dicarboxylate transport sensor protein DctB |
UniProt ID | P10047 |
◆ Recombinant Proteins | ||
RFL33391VF | Recombinant Full Length Vitis Vinifera Casp-Like Protein Gsvivt00034332001 (Vit_09S0002G03780) Protein, His-Tagged | +Inquiry |
TMEM190-16972M | Recombinant Mouse TMEM190 Protein | +Inquiry |
HP1BP3-4302M | Recombinant Mouse HP1BP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35162MF | Recombinant Full Length Mycobacterium Sp. Upf0353 Protein Mkms_2500 (Mkms_2500) Protein, His-Tagged | +Inquiry |
LDLR-3371R | Recombinant Rat LDLR Protein | +Inquiry |
◆ Native Proteins | ||
KLK4-238H | Native Human Kallikrein | +Inquiry |
Heparin-200S | Active Native Swine Heparin | +Inquiry |
Lectin-1813P | Active Native Peanut Lectin Protein, Biotinylated | +Inquiry |
Peroxidase-32H | Active Native Horseradish Peroxidase | +Inquiry |
CAT-26409TH | Native Human CAT | +Inquiry |
◆ Cell & Tissue Lysates | ||
RIMKLB-588HCL | Recombinant Human RIMKLB cell lysate | +Inquiry |
TLK2-001HCL | Recombinant Human TLK2 cell lysate | +Inquiry |
PTP4A1-2695HCL | Recombinant Human PTP4A1 293 Cell Lysate | +Inquiry |
GABRE-6059HCL | Recombinant Human GABRE 293 Cell Lysate | +Inquiry |
CCNT1-308HCL | Recombinant Human CCNT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All dctB Products
Required fields are marked with *
My Review for All dctB Products
Required fields are marked with *
0
Inquiry Basket