Recombinant Full Length Burkholderia Pseudomallei Translocator Protein Bipb(Bipb) Protein, His-Tagged
Cat.No. : | RFL34587BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Translocator protein BipB(bipB) Protein (Q3JL23) (1-620aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-620) |
Form : | Lyophilized powder |
AA Sequence : | MSSGVQGGPAAHANAYQTHPLRDAASALGTLSPQAYVDVVSAAQRNFLERMSQLASEQCD AQPAAHDARLDDKPALRAPQERDAPPLGASDTGSRASGAAKLTELLGVLMSVISASSLDE LKQRSDIWNQMSKAAQDNLSRLSDAFQRATDEAKAAADAAEQAAAAAKQAGADAKAADAA VDAAQKQYDDAVKQGLPDDRLQSLKAALEQARQQAGDAHGRADALQADATKKLDAASALA TQARACEQQVDDAVNQATQQYGASASLRTPQSPRLSGAAELTAVLGKLQELISSGNVKEL ESKQKLFTEMQAKREAELQKKSDEYQAQVKKAEEMQKTMGCIGKIVGWVITAVSFAAAAF TGGASLALAAVGLALAVGDEISRATTGVSFMDKLMQPVMDAILKPLMEMISSLITKALVA CGVDQQKAELAGAILGAVVTGVALVAAAFVGASAVKAVASKVIDAMAGQLTKLMDSAIGK MLVQLIEKFSEKSGLQALGSRTATAMTRMRRAIGVEAKEDGMLLANRFEKAGTVMNVGNQ VSQAAGGIVVGVERAKAMGLLADVKEAMYDIKLLGDLLKQAVDAFAEHNRVLAQLMQQMS DAGEMQTSTGKLILRNARAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bipB |
Synonyms | bipB; BURPS1710b_A0571; Translocator protein BipB |
UniProt ID | Q3JL23 |
◆ Recombinant Proteins | ||
TXN-793HFL | Recombinant Full Length Human TXN Protein, C-Flag-tagged | +Inquiry |
CCL11-507R | Recombinant Rhesus Macaque CCL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cd38-8742RA | Recombinant Rat Cd38 protein, Fc-tagged, APC labeled | +Inquiry |
PADI4-4937H | Recombinant Human PADI4 protein, His&Myc-tagged | +Inquiry |
KAAG1-3501H | Recombinant Human KAAG1, His-tagged | +Inquiry |
◆ Native Proteins | ||
LEP-27641TH | Native Human LEP | +Inquiry |
APOA1-256H | Native Human APOA1 protein | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
Mucin-232P | Native Porcine Mucin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LHX3-4750HCL | Recombinant Human LHX3 293 Cell Lysate | +Inquiry |
CDX1-7603HCL | Recombinant Human CDX1 293 Cell Lysate | +Inquiry |
SAC3D1-2076HCL | Recombinant Human SAC3D1 293 Cell Lysate | +Inquiry |
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
SOX11-1564HCL | Recombinant Human SOX11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All bipB Products
Required fields are marked with *
My Review for All bipB Products
Required fields are marked with *
0
Inquiry Basket