Recombinant Full Length Burkholderia Pseudomallei Sensor Protein Irls(Irls) Protein, His-Tagged
Cat.No. : | RFL22187HF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Sensor protein irlS(irlS) Protein (O31396) (1-464aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-464) |
Form : | Lyophilized powder |
AA Sequence : | MIRRLLPRTLRARLTALIILSTAATLALSGVALYSALHNRLVGMSSYEMSATLAAMRTHL ANVANVDDIPRKSDLWIDQLHGHQNLDLAIYDTDGRLRFATRGFVAPRPALGAPQTRVPA SAAPAGATFSYLADDAPLRGGNPRTARIVVQYDGKNDHALLRAYAYTVVVIEVLAVVLTA ALAYGIAMLGLSPLRRLVARAEQMSSSRLAQPLPELDTSGELKEMEHAFNAMLKRLDESF VRLSQFSSNLAHDMRTPLTNLLAEAQVALSKPRTADEYRDVIESSIDEYQRLSRMIEDML FLARSDNAQSHLAIRTLDAAAQAERVAGYYEPMAEDADVRIVVRGKAEVRADALLYHRAL SNLISNALNHAPRGSTITIECAQAADAATISVSDTGRGIEAPHRERIFERFYRVDPARHN SASGTGLGLAIVRSIMENHGGTCGVDSEPHVRTTFWLKFPAHAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Burkholderia pseudomallei Sensor protein irlS(irlS) |
UniProt ID | O31396 |
◆ Recombinant Proteins | ||
LCN15-524H | Recombinant Human LCN15, GST-tagged | +Inquiry |
Bcar3-1841M | Recombinant Mouse Bcar3 Protein, Myc/DDK-tagged | +Inquiry |
Mrpl38-4155M | Recombinant Mouse Mrpl38 Protein, Myc/DDK-tagged | +Inquiry |
3C protease-01H | Active Recombinant HRV 3C protease, N-His-tagged | +Inquiry |
Gtf2h5-3327M | Recombinant Mouse Gtf2h5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
Sphingomyelinase-38S | Active Native Staphylococcus aureus Sphingomyelinase | +Inquiry |
SERPINC1 -50P | Native Porcine Antithrombin III | +Inquiry |
Troponin-16R | Native Rabbit Skeletal Muscle Troponin ITC Complex | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKFY1-77HCL | Recombinant Human ANKFY1 cell lysate | +Inquiry |
CCL11-7735HCL | Recombinant Human CCL11 293 Cell Lysate | +Inquiry |
ITM2A-5118HCL | Recombinant Human ITM2A 293 Cell Lysate | +Inquiry |
PLK1-532MCL | Recombinant Mouse PLK1 cell lysate | +Inquiry |
TNFSF13B-1014CCL | Recombinant Cynomolgus TNFSF13B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Burkholderia pseudomallei Sensor protein irlS(irlS) Products
Required fields are marked with *
My Review for All Burkholderia pseudomallei Sensor protein irlS(irlS) Products
Required fields are marked with *
0
Inquiry Basket