Recombinant Full Length Burkholderia Mallei Probable Ubiquinone Biosynthesis Protein Ubib(Ubib) Protein, His-Tagged
Cat.No. : | RFL28300BF |
Product Overview : | Recombinant Full Length Burkholderia mallei Probable ubiquinone biosynthesis protein UbiB(ubiB) Protein (A3MNU1) (1-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia Mallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-525) |
Form : | Lyophilized powder |
AA Sequence : | MRIFRFVKIVFTVIRFGLDEVMLSRIENPRVKLLLRITTIGRRFADPPAVRLRRALESLG PIFVKFGQVLSTRRDLLPVDFANELAKLQDQVPPFDSAVAIAIVEKSLGARIDVLFDEFE RVPVASASIAQVHFAKLKQGEHKGKAVAVKVLRPNMLPVIDSDLALMRDIATWAERLWAD GRRLKPREVVAEFDKYLHDELDLMREAANGSQLRRNFAGLDLLLVPEMFWDYSTPAVLVM ERMTGVPISQVDTLRAAGVDIPKLAREGVEIFFTQVFRDGFFHADMHPGNIQVSLDPKHF GRYIALDFGIVGALSDFDKNYLAQNFLAFFKRDYHRVATLHLESGWVPPDTRVEELESAI RAVCEPYFDRALKDISLGQVLMRLFSTSRRFNVEIQPQLVLLQKTMLNVEGLGRSLDPEL DLWKTAKPYLERWMTEQIGLRGWYERFKVEAPQWSKTLPQLPRLVHQALISHHEAPRAIS DDLIRQILVEQRRTNRLLQALLVFGLAVGAGAVIARVLIVLAYGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ubiB |
Synonyms | ubiB; BMA10247_2401; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB |
UniProt ID | A3MNU1 |
◆ Recombinant Proteins | ||
RFL11360NF | Recombinant Full Length Neisseria Gonorrhoeae Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
ASPHD2-4987Z | Recombinant Zebrafish ASPHD2 | +Inquiry |
Folh1-907M | Recombinant Mouse Folh1 protein, His-tagged | +Inquiry |
FCGBP-1488H | Recombinant Human FCGBP protein, His-tagged | +Inquiry |
GAPDH-2544H | Recombinant Human GAPDH protein(11-330 aa), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
IGHG1-617H | Native Human Immunoglobulin Heavy Constant Gamma 1 (G1m marker) | +Inquiry |
ORM1-27283TH | Native Human ORM1 | +Inquiry |
Lectin-1766D | Active Native Datura Stramonium Lectin Protein, Biotinylated | +Inquiry |
Immunoglobulin A1-77H | Native Human Immunoglobulin A1 | +Inquiry |
PLG-27842TH | Native Human PLG | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK18-925HCL | Recombinant Human KCNK18 Lysate | +Inquiry |
PRPSAP2-2818HCL | Recombinant Human PRPSAP2 293 Cell Lysate | +Inquiry |
DUSP11-6783HCL | Recombinant Human DUSP11 293 Cell Lysate | +Inquiry |
RAB3B-522HCL | Recombinant Human RAB3B lysate | +Inquiry |
ChoroidsPlexus-425S | Sheep Choroids Plexus Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ubiB Products
Required fields are marked with *
My Review for All ubiB Products
Required fields are marked with *
0
Inquiry Basket