Recombinant Full Length Buchnera Aphidicola Subsp. Baizongia Pistaciae Upf0053 Protein Bbp_300(Bbp_300) Protein, His-Tagged
Cat.No. : | RFL22872BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Baizongia pistaciae UPF0053 protein bbp_300(bbp_300) Protein (Q89AI6) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Baizongia pistaciae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MELFLDPSTWAGLLTLIILEIVLGIDNLVFVAILSEKLPPCKQDKARLIGLSFALFMRLG LLALMSWMVTLTSEIISNKYFSFSGRDLILLFGGLFLLFKATIELHERLDNDIQKNENNK HYAGFWTIVIQIVILDSIFSLDAIITAVGTINNLPIMMIAVVIAMVLMLIASKPLTKFIN LHQTVVVLCLSFLLMIGCNLVSEALGFYVPKGYLYAAIGFSIIIEIFNQIARRNFMLHQS RRPMRQRAAEAILRLMIGDQFRNTTTNISTKNKDKEKIRNRTTDTESFKEEERYMINGVL TLAARSIRSIMTPRNEISWVNIYQPKNKIRSQLLDTPHSLFPVCKGQLDEVIGIVRAKEL LVALERTINIIDFSSTTLPIIIPDTLDPINLLGVLRRAKGSLVIVTNEFGAVQGLITPLD VLEAIAGEFPDADETPDIIFEKDSWLVKGGTDLHSLQQCLNITNLIKQENSYASLAGLLI AQKGQLPLPGETIVIPPLRFYILEATQYRINLVRITKQH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bbp_300 |
Synonyms | bbp_300; UPF0053 protein bbp_300 |
UniProt ID | Q89AI6 |
◆ Recombinant Proteins | ||
ATL1-832M | Recombinant Mouse ATL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRB1-2951R | Recombinant Rat KLRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CA-077H | Recombinant Human PPP2CA Protein, octahistidine/streptactin-tagged | +Inquiry |
Ldlr-646M | Active Recombinant Mouse Ldlr Protein, His-tagged | +Inquiry |
CCL5-427F | Recombinant Feline CCL5 Protein | +Inquiry |
◆ Native Proteins | ||
MMP9-40H | Native Human MMP-9/Lipocalin/TIMP-1 Complex | +Inquiry |
HB-40C | Native Cattle Hemoglobin (HB) Protein | +Inquiry |
PROC-272B | Active Native Bovine Activated Protein C | +Inquiry |
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO2A-7342HCL | Recombinant Human CORO2A 293 Cell Lysate | +Inquiry |
Lymphoma-333H | Human Lymphoma Membrane Tumor Lysate | +Inquiry |
DPP8-6830HCL | Recombinant Human DPP8 293 Cell Lysate | +Inquiry |
KEAP1-001HCL | Recombinant Human KEAP1 cell lysate | +Inquiry |
UFC1-522HCL | Recombinant Human UFC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bbp_300 Products
Required fields are marked with *
My Review for All bbp_300 Products
Required fields are marked with *
0
Inquiry Basket