Recombinant Full Length Buchnera Aphidicola Subsp. Baizongia Pistaciae Uncharacterized Metalloprotease Bbp_296(Bbp_296) Protein, His-Tagged
Cat.No. : | RFL11745BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Baizongia pistaciae Uncharacterized metalloprotease bbp_296(bbp_296) Protein (Q89AI9) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Baizongia pistaciae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MTKCNIFNMIFLKFSNAFIKKIKYLSIISIISVFLLNSSIVYSCSKIILIFDNNFKENNK NILNKLVLPIKNIILKGTSNLEFNDYLLKLSNFYGSPIHKCIYNFPYKKLQNNNLNNLKY IIFKSKIDNNFIKNMQYLNVSNDNIDNVVRCIKLELKIHQLKQDHKCNILIQNNSFLKHN IVQKNIILSFEIPYNTKNIYGFFTKKNKFFDVHGISSAPIFLKFPFLKKYRISSKFNPNR FNPITKKNSPHQGIDFAMPIGTPILSIGDGVILNAKFSIQAGNYITIQHNCSYITKYMHL KKILVKIGDKVKMRDKIGLSGNTGYSTGPHLHYEVWLHKKVINPKNLKTRECLIKKNLKE HINFSNIIITQFEIFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | bbp_296 |
Synonyms | bbp_296; Uncharacterized metalloprotease bbp_296 |
UniProt ID | Q89AI9 |
◆ Recombinant Proteins | ||
ADRB2-25H | Recombinant Human ADRB2 protein | +Inquiry |
RFL29066SF | Recombinant Full Length Solanum Lycopersicum Photosystem Ii Cp43 Chlorophyll Apoprotein(Psbc) Protein, His-Tagged | +Inquiry |
CCNDBP1-0663H | Recombinant Human CCNDBP1 Protein, GST-Tagged | +Inquiry |
PPP6R2-2878H | Recombinant Human PPP6R2 Protein, MYC/DDK-tagged | +Inquiry |
ORMDL1-6409M | Recombinant Mouse ORMDL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
C3b-03M | Native Monkey C3b Protein | +Inquiry |
Mb-8232R | Native Rat Myoglobin | +Inquiry |
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
ELANE-3221H | Active Native Human ELANE Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
MRPL43-4166HCL | Recombinant Human MRPL43 293 Cell Lysate | +Inquiry |
Skeletal Muscle-425H | Human Skeletal Muscle Diabetic Disease Lysate | +Inquiry |
CYP17A1-7128HCL | Recombinant Human CYP17A1 293 Cell Lysate | +Inquiry |
MBD5-1066HCL | Recombinant Human MBD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All bbp_296 Products
Required fields are marked with *
My Review for All bbp_296 Products
Required fields are marked with *
0
Inquiry Basket