Recombinant Full Length Buchnera Aphidicola Subsp. Baizongia Pistaciae Protein Hflk(Hflk) Protein, His-Tagged
Cat.No. : | RFL24049BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Baizongia pistaciae Protein HflK(hflK) Protein (Q89A39) (1-417aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera aphidicola subsp. Baizongia pistaciae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-417) |
Form : | Lyophilized powder |
AA Sequence : | MEKNMAWNEPSDSEKDKDPWNKKDKKLKNFDENKKSKLYLFLEIECLVNFLKRKKKIFFS ESGSFKYFKNLITMIIFTTIIFLIGSGFYFIQESEYGVVTCFGKFSYLANPGLHWKPILI QKVIPIDVSTVREINTSGTILTYSEHFVQVNMTVQYRIVDPKKYLFSVTNPDNCLRQSIN SALRSVISRSNIDIFLKNEFSLLAKNDIKVNIQKIIKPYHMGIVISDINFRTLYLPQAVK LAFEDIFSAIESKKQSLNEARIYSNEIKSQAFYNAKKILIEAKSDRLRTILNAQGIIFKF LKILPIYKSSKKITTIQLYFDCMEKIFSHTRKVLTNSDNNFFLFSLNDLFLKNNYNSLTQ SHSNSNKHSSMLNTVSSSHVKSIDHVNSNNLLISSNNIINQRKLNSFRKDYLRIGRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hflK |
Synonyms | hflK; bbp_513; Protein HflK |
UniProt ID | Q89A39 |
◆ Recombinant Proteins | ||
LSM14A-3036H | Recombinant Human LSM14A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CHIT1-3741H | Recombinant Human CHIT1 protein, His-tagged | +Inquiry |
ZNF189-5308R | Recombinant Rhesus monkey ZNF189 Protein, His-tagged | +Inquiry |
PDCD1LG2-3158R | Recombinant Rhesus Macaque PDCD1LG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNM2-11H | Recombinant Human DNM2 Protein | +Inquiry |
◆ Native Proteins | ||
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
IGHA2-615H | Native Human Immunoglobulin Heavy Constant Alpha 2 (A2m marker) | +Inquiry |
Alb-7992M | Native Mouse Serum Albumin | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Lung-109M | Mouse Lung Tissue Lysate (7 Days Old) | +Inquiry |
C1orf210-8166HCL | Recombinant Human C1orf210 293 Cell Lysate | +Inquiry |
SDHB-2009HCL | Recombinant Human SDHB 293 Cell Lysate | +Inquiry |
GTPBP8-5681HCL | Recombinant Human GTPBP8 293 Cell Lysate | +Inquiry |
NBPF1-433HCL | Recombinant Human NBPF1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hflK Products
Required fields are marked with *
My Review for All hflK Products
Required fields are marked with *
0
Inquiry Basket