Recombinant Human DNM2 Protein
Cat.No. : | DNM2-11H |
Product Overview : | Recombinant Human DNM2 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 533-824 aa |
Description : | Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Five alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined. |
Form : | Liquid. In 1xPBS, pH7.4. |
Molecular Mass : | ~36.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFLMKGGSKEYWFVLTAESLSWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDL |
Purity : | >90% |
Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.26 mg/ml |
Official Full Name : | Dynamin 2 |
Gene Name | DNM2 dynamin 2 [ Homo sapiens (human) ] |
Official Symbol | DNM2 |
Synonyms | DYN2; CMT2M; DYNII; LCCS5; CMTDI1; CMTDIB; DI-CMTB |
Gene ID | 1785 |
mRNA Refseq | NM_001005360 |
Protein Refseq | NP_001005360 |
MIM | 602378 |
UniProt ID | P50570 |
◆ Recombinant Proteins | ||
DNM2-12105H | Recombinant Human DNM2, GST-tagged | +Inquiry |
DNM2-1976H | Recombinant Human DNM2 Protein (Leu533-Glu731), N-His tagged | +Inquiry |
DNM2-2786H | Recombinant Human DNM2 Protein, GST-tagged | +Inquiry |
DNM2-20H | Recombinant Human DNM2 Protein | +Inquiry |
DNM2-17H | Recombinant Human DNM2, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNM2-6857HCL | Recombinant Human DNM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNM2 Products
Required fields are marked with *
My Review for All DNM2 Products
Required fields are marked with *
0
Inquiry Basket