Recombinant Full Length Brucella Suis Biovar 1 Type Iv Secretion System Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL31064BF |
Product Overview : | Recombinant Full Length Brucella suis biovar 1 Type IV secretion system protein virB10(virB10) Protein (Q9RPX5) (1-391aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis biovar 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-391) |
Form : | Lyophilized powder |
AA Sequence : | MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAEN NHHSDKTMVQTSTVPMRTFKLPPPPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLP DDTPAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGS LGTLLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNG KVLLIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYI DSHFWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINI PPTLYKNQGEEIGIYIARDLDFSSVYDVKPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; BRA0060; BS1330_II0060; Type IV secretion system protein virB10 |
UniProt ID | Q9RPX5 |
◆ Recombinant Proteins | ||
ITGA5-101H | Recombinant Human ITGAV/ITGB3 Heterodimer Protein, His-tagged | +Inquiry |
RFL318RF | Recombinant Full Length Rat Atrial Natriuretic Peptide Receptor 3(Npr3) Protein, His-Tagged | +Inquiry |
Dsg3-2828M | Recombinant Mouse Dsg3 protein, His-tagged | +Inquiry |
DEFB4A-540H | Active Recombinant Human DEFB4A Protein | +Inquiry |
Tbx3-1588R | Recombinant Rat Tbx3 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Skeletal Muscles-012H | Human Skeletal Muscles Lysate, Total Protein | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
IgG1 Fc-08H | Native Human Immunoglobulin G1 (IgG1) FC Fragment | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KDSR-356HCL | Recombinant Human KDSR lysate | +Inquiry |
PGK2-3256HCL | Recombinant Human PGK2 293 Cell Lysate | +Inquiry |
SENP8-1970HCL | Recombinant Human SENP8 293 Cell Lysate | +Inquiry |
IDO1-5300HCL | Recombinant Human IDO1 293 Cell Lysate | +Inquiry |
HOMER1-806HCL | Recombinant Human HOMER1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket