Recombinant Full Length Brucella Suis Biovar 1 Putative Zinc Metalloprotease Br1156/Bs1330_I1152(Br1156, Bs1330_I1152) Protein, His-Tagged
Cat.No. : | RFL35394BF |
Product Overview : | Recombinant Full Length Brucella suis biovar 1 Putative zinc metalloprotease BR1156/BS1330_I1152(BR1156, BS1330_I1152) Protein (Q8G0E1) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis biovar 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MQEALALFFGSESLLVGTIIPFLFVLTVVVFVHEMGHYLVARWCGIGAQAFSIGFGPELL GFTDRHGTRWKLSAIPLGGYVKFIGDESETSSPVGVNESALSEEDRKRAFHTQPVWKRAA TVFAGPAFNIILTIAIFSVFFALYGRQIADPLIAGVQPGSPAAEAGFEPGDRFVSVEGEK ITTFADVQRIVSGRAGDKLNFTVERDGKMVDLQAVPKIVERTDPLGNKVKLGAIGVETTE AVGNFRRIEYGPLESVGQAVIETGHIIGRTGEFFKRFAVGREDKCQLGGPVKIATMASKA ASQGFDWLIQLMAMLSIGIGLLNLFPLPPLDGGHLVFYAVEAIKGSPVSGAAQEIFYRIG FLLVMGFMGFVLFNDLFAC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BR1156 |
Synonyms | BR1156; BS1330_I1152; Putative zinc metalloprotease BR1156/BS1330_I1152 |
UniProt ID | Q8G0E1 |
◆ Recombinant Proteins | ||
EFNA2-3098H | Recombinant Human EFNA2 Protein, GST-tagged | +Inquiry |
GP1BB-5132H | Recombinant Human GP1BB Protein | +Inquiry |
ZNF740B-4521Z | Recombinant Zebrafish ZNF740B | +Inquiry |
RTN4RL2-5198R | Recombinant Rat RTN4RL2 Protein | +Inquiry |
MEF2D-598HFL | Recombinant Full Length Human MEF2D Protein | +Inquiry |
◆ Native Proteins | ||
PGC-8318H | Native Human PGC | +Inquiry |
Serpinc1-298M | Active Native Mouse Antithrombin III | +Inquiry |
BCHE-8E | Active Native Equine Butyrylcholine esterase | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIMAP2-705HCL | Recombinant Human GIMAP2 cell lysate | +Inquiry |
AGMAT-8978HCL | Recombinant Human AGMAT 293 Cell Lysate | +Inquiry |
AAK1-2106HCL | Recombinant Human AAK1 cell lysate | +Inquiry |
CCKBR-168HCL | Recombinant Human CCKBR lysate | +Inquiry |
CCR5-309HCL | Recombinant Human CCR5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BR1156 Products
Required fields are marked with *
My Review for All BR1156 Products
Required fields are marked with *
0
Inquiry Basket