Recombinant Full Length Brucella Suis Biovar 1 Putative Peptide Transport System Permease Protein Bra1092/Bs1330_Ii1084(Bra1092, Bs1330_Ii1084) Protein, His-Tagged
Cat.No. : | RFL31734BF |
Product Overview : | Recombinant Full Length Brucella suis biovar 1 Putative peptide transport system permease protein BRA1092/BS1330_II1084(BRA1092, BS1330_II1084) Protein (Q8FUX0) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis biovar 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-314) |
Form : | Lyophilized powder |
AA Sequence : | MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQP TVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVA AYLRDSWFDMGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLRS LILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVL TVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLV DILYTIADPRVHYD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BRA1092 |
Synonyms | BRA1092; BS1330_II1084; Putative peptide transport system permease protein BRA1092/BS1330_II1084 |
UniProt ID | Q8FUX0 |
◆ Native Proteins | ||
LDL-333H | Native Human LDL Protein | +Inquiry |
FDP-X-51H | Native Human Fibrinogen Degrading Product-X | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
Lectin-1870W | Active Native Wisteria Floribunda Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKS3-26HCL | Recombinant Human ANKS3 lysate | +Inquiry |
LEP-4773HCL | Recombinant Human LEP 293 Cell Lysate | +Inquiry |
SLCO1B3-1688HCL | Recombinant Human SLCO1B3 293 Cell Lysate | +Inquiry |
PSKH2-2781HCL | Recombinant Human PSKH2 293 Cell Lysate | +Inquiry |
H3F3B-5653HCL | Recombinant Human H3F3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All BRA1092 Products
Required fields are marked with *
My Review for All BRA1092 Products
Required fields are marked with *
0
Inquiry Basket