Recombinant Full Length Brucella Suis Biovar 1 Atp Synthase Subunit B 1(Atpf1) Protein, His-Tagged
Cat.No. : | RFL16518BF |
Product Overview : | Recombinant Full Length Brucella suis biovar 1 ATP synthase subunit b 1(atpF1) Protein (Q8G2D9) (1-208aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella suis biovar 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-208) |
Form : | Lyophilized powder |
AA Sequence : | MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atpF1 |
Synonyms | atpF1; BR0384; BS1330_I0385; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1 |
UniProt ID | Q8G2D9 |
◆ Recombinant Proteins | ||
THI2.1-2137V | Recombinant Viscum Album THI2.1 Protein (27-72 aa), His-tagged | +Inquiry |
RPLP1-10387Z | Recombinant Zebrafish RPLP1 | +Inquiry |
CBLN3-2324H | Recombinant Human CBLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL35164MF | Recombinant Full Length Mouse Fatty Acyl-Coa Reductase 1(Far1) Protein, His-Tagged | +Inquiry |
EMC9-1173H | Recombinant Human EMC9 Protein (1-208 aa), His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
F2-73R | Native Rat Prothrombin | +Inquiry |
OXT-5360H | Native Human Oxytocin, Prepropeptide | +Inquiry |
DES-167C | Native chicken DES | +Inquiry |
IgG-328S | Native Swine Gamma Globulin Fraction | +Inquiry |
C5-53H | Native Human Complement C5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF11-001CCL | Recombinant Cynomolgus TNFSF11 cell lysate | +Inquiry |
MUTYH-4052HCL | Recombinant Human MUTYH 293 Cell Lysate | +Inquiry |
MOCS3-4259HCL | Recombinant Human MOCS3 293 Cell Lysate | +Inquiry |
KDELC2-5002HCL | Recombinant Human KDELC2 293 Cell Lysate | +Inquiry |
ELF2-6633HCL | Recombinant Human ELF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All atpF1 Products
Required fields are marked with *
My Review for All atpF1 Products
Required fields are marked with *
0
Inquiry Basket