Recombinant Full Length Brucella Abortus Type Iv Secretion System Protein Virb10(Virb10) Protein, His-Tagged
Cat.No. : | RFL22914BF |
Product Overview : | Recombinant Full Length Brucella abortus Type IV secretion system protein virB10(virB10) Protein (Q2YJ81) (1-388aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brucella Abortus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-388) |
Form : | Lyophilized powder |
AA Sequence : | MTQENIPVQPGTLDGERGLPTVNENGSGRTRKVLLFLFVVGFIVVLLLLLVFHMRGNAEN NHHSDKTMVQTSTVPMRTFKLPPPPPPAPPEPPAPPPAPAMPIAEPAAAALSLPPLPDDT PAKDDVLDKSASALMVVTKSSGDTNAQTAGDTVVQTTNARIQALLDSQKNTKQDAGSLGT LLHGTQTDARMASLLRNRDFLLAKGSIINCALQTRLDSTVPGMAACVVTRNMYSDNGKVL LIERGSTISGEYDANVKQGMARIYVLWTRVKTPNGVVIDLDSPGADPLGGAGLPGYIDSH FWKRFGGALMLSTIETLGRYATQKVGGGGSNQINLNTGGGESTSNLASTALKDTINIPPT LYKNQGEEIGIYIARDLDFSSVYDVKPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | virB10 |
Synonyms | virB10; BAB2_0059; Type IV secretion system protein virB10 |
UniProt ID | Q2YJ81 |
◆ Recombinant Proteins | ||
AKR1B10-410H | Recombinant Human AKR1B10 Protein, GST-tagged | +Inquiry |
ATP2B4-520R | Recombinant Rat ATP2B4 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKCB-1764H | Recombinant Human PRKCB Protein, His (Fc)-Avi-tagged | +Inquiry |
TCEANC2-5985R | Recombinant Rat TCEANC2 Protein | +Inquiry |
KITLG-217H | Active Recombinant Human KITLG Protein (Glu26-Ala189), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Native Proteins | ||
APOC1-616H | Native Human Apolipoprotein C-I | +Inquiry |
LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
Proteasome 20S-37H | Native Human Proteasome 20S Protein, Tag Free | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDRG4-3928HCL | Recombinant Human NDRG4 293 Cell Lysate | +Inquiry |
SLC22A12-1796HCL | Recombinant Human SLC22A12 293 Cell Lysate | +Inquiry |
RPA3-2241HCL | Recombinant Human RPA3 293 Cell Lysate | +Inquiry |
SPAG8-1547HCL | Recombinant Human SPAG8 293 Cell Lysate | +Inquiry |
SRSF12-1905HCL | Recombinant Human SFRS13B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All virB10 Products
Required fields are marked with *
My Review for All virB10 Products
Required fields are marked with *
0
Inquiry Basket