Recombinant Full Length Brassica Napus Squalene Monooxygenase 1,1(Sqp1,1) Protein, His-Tagged
Cat.No. : | RFL28575BF |
Product Overview : | Recombinant Full Length Brassica napus Squalene monooxygenase 1,1(SQP1,1) Protein (O65727) (1-506aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brassica napus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-506) |
Form : | Lyophilized powder |
AA Sequence : | MDLAFPHVCLWTLLAFVLTWTVFYVNNRRKKVAKLPDAATEVRRDGDADVIIVGAGVGGS ALAYALAKDGRRVHVIERDMREPVRMMGEFMQPGGRLLLSKLGLEDCLEGIDEQIATGLA VYKDGQKALVSFPEDNDFPYEPTGRAFYNGRFVQRLRQKASSLPTVQLEEGTVKSLIEEK GVIKGVTYKNSAGEETTAFAPLTVVCDGCYSNLRRSVNDNNAEVISYQVGYVSKNCQLED PEKLKLIMSKPSFTMLYQISSTDVRCVMEIFPGNIPSISNGEMAVYLKNTMAPQVPPELR KIFLKGIDEGAQIKAMPTKRMEATLSEKQGVIVLGDAFNMRHPAIASGMMVVLSDILILR RLLQPLRNLSDANKVSEVIKSFYVIRKPMSATVNTLGNAFSQVLIASTDEAKEAMRQGCF DYLSSGGFRTSGMMALLGGMNPRPLSLIFHLCGITLSSIGQLLSPFPSPLGIWHSLRLFG AEGVSQMLSPAYAAAYRKSYMTATAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SQP1 |
Synonyms | SQP1,1; Squalene monooxygenase 1,1; Squalene epoxidase 1,1; SE 1,1 |
UniProt ID | O65727 |
◆ Recombinant Proteins | ||
ADPRHL2-9440H | Recombinant Human ADPRHL2 protein, His-tagged | +Inquiry |
GPR62-5625HF | Recombinant Full Length Human GPR62 Protein, GST-tagged | +Inquiry |
L1CAM-553HFL | Recombinant Full Length Human L1CAM Protein, C-Flag-tagged | +Inquiry |
IFNA2-222H | Recombinant Human IFNA2, StrepII-tagged | +Inquiry |
WT1-1210H | Active Recombinant Human Wilms Tumor 1 | +Inquiry |
◆ Native Proteins | ||
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
FABP3-27801TH | Native Human FABP3 protein | +Inquiry |
FGG -41B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
CTSL-191H | Active Native Human Cathepsin L | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITM2B-5117HCL | Recombinant Human ITM2B 293 Cell Lysate | +Inquiry |
BLMH-8445HCL | Recombinant Human BLMH 293 Cell Lysate | +Inquiry |
TOR1AIP2-865HCL | Recombinant Human TOR1AIP2 293 Cell Lysate | +Inquiry |
PIGN-3196HCL | Recombinant Human PIGN 293 Cell Lysate | +Inquiry |
Colon-840P | Pig Colon Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SQP1 Products
Required fields are marked with *
My Review for All SQP1 Products
Required fields are marked with *
0
Inquiry Basket