Recombinant Full Length Brassica Napus Oleosin-B3(Olnb3) Protein, His-Tagged
Cat.No. : | RFL29805BF |
Product Overview : | Recombinant Full Length Brassica napus Oleosin-B3(OlnB3) Protein (Q42626) (109-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brassica napus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (109-424) |
Form : | Lyophilized powder |
AA Sequence : | LGIPESIKPSNVIPESIKPSNIIPESIKPSNIIPVSIKPSNIKDKIKDTIGKVKNKIKAK QEEKSKGKSEDSSKGKGKSKGEDTTTDEDKHGKGESKHGKGESKHGKGESTHGKGGKHGS EGSSMDEGKHGGKHGSGGSPMGGGKHGSGGKHESGGSPMGGGKHGSGGKHESGGASMGGG KHESVGKHGSGGKHESGGSPMGGGKHGSGGKHESGGASMGGGKHGSGGRHEGGGSAMGGG KHGSGGKHGSEGKHGGEGSSMGKNSLSKNKKEFHYRGQAMDASSTSESSDGSSSDGSSSD GSSSDGSSHGSGGKHI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OlnB3 |
Synonyms | OlnB3; STA; 41-2; Oleosin-B3 |
UniProt ID | Q42626 |
◆ Recombinant Proteins | ||
PIK3R1-4864H | Recombinant Human Phosphoinositide-3-Kinase, Regulatory Subunit 1 (Alpha), His-tagged | +Inquiry |
ZNF670-766H | Recombinant Human ZNF670 Protein, His-tagged | +Inquiry |
HBP1-3031Z | Recombinant Zebrafish HBP1 | +Inquiry |
RFL34644SF | Recombinant Full Length Sorghum Bicolor Atp Synthase Subunit B, Chloroplastic(Atpf) Protein, His-Tagged | +Inquiry |
HMGCS2-3649HF | Recombinant Full Length Human HMGCS2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FABP1-509H | Native Human FABP1 | +Inquiry |
PT-141B | Native Bordetella pertussis Perrtussis toxin | +Inquiry |
AK1-6667C | Active Native Chicken AK1 | +Inquiry |
F10-63H | Native Human Factor X | +Inquiry |
BCC-162B | Native Bovine Cholesterol Concentrate | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARVELD3-1063HCL | Recombinant Human MARVELD3 cell lysate | +Inquiry |
FBXO22-6304HCL | Recombinant Human FBXO22 293 Cell Lysate | +Inquiry |
SIRT3-1833HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
SAT1-2056HCL | Recombinant Human SAT1 293 Cell Lysate | +Inquiry |
ARHGAP26-111HCL | Recombinant Human ARHGAP26 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OlnB3 Products
Required fields are marked with *
My Review for All OlnB3 Products
Required fields are marked with *
0
Inquiry Basket