Recombinant Full Length Brassica Juncea Omega-6 Fatty Acid Desaturase, Endoplasmic Reticulum Protein, His-Tagged
Cat.No. : | RFL19930BF |
Product Overview : | Recombinant Full Length Brassica juncea Omega-6 fatty acid desaturase, endoplasmic reticulum Protein (Q39287) (1-384aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Brassica juncea (Indian mustard) (Sinapis juncea) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-384) |
Form : | Lyophilized powder |
AA Sequence : | MGAGGRMQVSPSPKKSETDTLKRVPCETPPFTVGELKKAIPPHCFKRSIPRSFSYLIWDI IVASCFYYVATTYFPLLPHPLSYVAWPLYWACQGVVLTGVWVIAHECGHHAFSDYQWLDD TVGLIFHSFLLVPYFSWKYSHRRHHSNTGSLERDEVFVPKKKSDIKWYGKYLNNPLGRTV MLTVQFTLGWPLYWAFNVSGRPYPEGFACHFHPNAPIYNDRERLQIYVSDAGILAVCYGL YRYAAAQGVASMVCLYGVPLLIVNAFLVLITYLQHTHPSLPHYDSSEWDWLRGALATVDR DYGILNKVFHNITDTHVAHHLFSTMPHYHAMEVTKAIKPILGDYYQFDGTPWVKAMWREA KECIYVEPDRQGEKKGVFWYNNKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Brassica juncea Omega-6 fatty acid desaturase, endoplasmic reticulum |
Synonyms | Omega-6 fatty acid desaturase, endoplasmic reticulum; Delta(12 desaturase |
UniProt ID | Q39287 |
◆ Recombinant Proteins | ||
MERTK-2194M | Recombinant Mouse MERTK protein, Fc-tagged | +Inquiry |
RFL9882MF | Recombinant Full Length Macaca Mulatta Transmembrane O-Methyltransferase(Lrtomt) Protein, His-Tagged | +Inquiry |
TAAR7A-5892R | Recombinant Rat TAAR7A Protein | +Inquiry |
NUDT2-4116R | Recombinant Rat NUDT2 Protein | +Inquiry |
HN-9353M | Recombinant Mumps virus (strain SBL-1) HN Full Length Transmembrane protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type III-06H | Native Human Collagen Type III | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
LDH-215S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF5A-6641HCL | Recombinant Human EIF5A 293 Cell Lysate | +Inquiry |
HNRNPM-5440HCL | Recombinant Human HNRNPM 293 Cell Lysate | +Inquiry |
PTEN-2721HCL | Recombinant Human PTEN 293 Cell Lysate | +Inquiry |
HINT3-5556HCL | Recombinant Human HINT3 293 Cell Lysate | +Inquiry |
RSRC2-2127HCL | Recombinant Human RSRC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Brassica juncea Omega-6 fatty acid desaturase, endoplasmic reticulum Products
Required fields are marked with *
My Review for All Brassica juncea Omega-6 fatty acid desaturase, endoplasmic reticulum Products
Required fields are marked with *
0
Inquiry Basket