Active Recombinant Mouse Tnf Protein (152 aa)
Cat.No. : | Tnf-148T |
Product Overview : | Recombinant Mouse Tnf Protein (152 aa) without tag was expressed in P. pastoris. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | P.pastoris |
Protein Length : | 152 |
Description : | Sharing 79% sequence identity with human Tumor Necrosis Factor-alpha (hTNF-α), mouse Tumor Necrosis Factor-alpha (mTNF-α) is a cytokine mainly expressed by immune cells. A type II transmembrane protein, TNF-α is further proteolytically processed to a soluble form. The trimeric active TNF-α then exerts its diverse biological properties including gapoptosis, inflammation, autoimmunity and cell proliferation by binding to TNF Receptor 1 and 2. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 0.01 ng/mL, measured by cytotoxicity assay using L929 cells, corresponding to a specific activity of >1 × 10^8units/mg. |
Molecular Mass : | 17kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Endotoxin : | < 1 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by reducing SDS-PAGE. |
Storage : | Lyophilized recombinant mouse Tumor Necrosis Factor-alpha (rmTNF-α) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmTNF-αshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Tnf tumor necrosis factor [ Mus musculus ] |
Official Symbol | Tnf |
Synonyms | TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434; |
Gene ID | 21926 |
mRNA Refseq | NM_013693 |
Protein Refseq | NP_038721 |
UniProt ID | P06804 |
◆ Recombinant Proteins | ||
TNF-796R | Recombinant Rabbit Tumor Necrosis Factor | +Inquiry |
Tnf-237R | Recombinant Rat Tnf protein, His/S-tagged | +Inquiry |
Tnf-01M | Active Recombinant Mouse Tnf Protein, His-Tagged | +Inquiry |
TNF-346H | Recombinant Human TNF protein, His/MBP-tagged | +Inquiry |
TNF-24H | Recombinant Human Tumor Necrosis Factor alpha-1a | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *
0
Inquiry Basket