Active Recombinant Mouse Tnf Protein (152 aa)

• Cat.No.: Tnf-148T
• Product Overview: Recombinant Mouse Tnf Protein (152 aa) without tag was expressed in P. pastoris.

Specification

• Species: Mouse
• Source: P.pastoris
• Protein Length: 152
• Description: Sharing 79% sequence identity with human Tumor Necrosis Factor-alpha (hTNF-α), mouse Tumor Necrosis Factor-alpha (mTNF-α) is a cytokine mainly expressed by immune cells. A type II transmembrane protein, TNF-α is further proteolytically processed to a soluble form. The trimeric active TNF-α then exerts its diverse biological properties including gapoptosis, inflammation, autoimmunity and cell proliferation by binding to TNF Receptor 1 and 2.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.01 ng/mL, measured by cytotoxicity assay using L929 cells, corresponding to a specific activity of >1 × 10^8units/mg.
• Molecular Mass: 17kDa, observed by reducing SDS-PAGE.
• AA Sequence: SQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by reducing SDS-PAGE.
• Storage: Lyophilized recombinant mouse Tumor Necrosis Factor-alpha (rmTNF-α) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmTNF-αshould be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Tnf tumor necrosis factor [ Mus musculus ]
• Official Symbol: Tnf
• Synonyms: TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434
• Gene ID: 21926
• mRNA Refseq: NM_013693
• Protein Refseq: NP_038721
• UniProt ID: P06804