Recombinant Full Length Bovine Transmembrane Protein 184A(Tmem184A) Protein, His-Tagged
Cat.No. : | RFL26541BF |
Product Overview : | Recombinant Full Length Bovine Transmembrane protein 184A(TMEM184A) Protein (Q1RMW2) (1-414aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-414) |
Form : | Lyophilized powder |
AA Sequence : | MTDTPGLLGTPLAWTPPARPAGPQMERAGNGSQGPGPLFLTSPLARGVSGVFVWAALVLT GHQIYLHLRSYTVPHEQRYIIRLLFIVPVYAFDSWLSLLLLGGHQHYIYFDSVRDCYEAF VIYSFLSLCFQYLGGESAIMAEIRGKPVRTSCFHGTCCLRGMTYSIGFLRFCKQATLQFC IVKPIMALVTIVLQAFGKYHDGDFNVRSGYLYITLVYNASVSLALYALFLFYSATRELLQ PFEPVLKFLTIKAVIFLSFWQGLLLAILERCGVIPEVQVIDGSTVGAGTVAAGYQNFIIC IEMLFASIALRYAFTCQVYSEKTESSPAPSAPMQSISSGLKETMSPQDIVQDAIHNFSPA YQKYTQQATQEAPRPGQGSVPSPRTPTHSPDGGPGGGRKGRNVEKRMLIPAEEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM184A |
Synonyms | TMEM184A; Transmembrane protein 184A |
UniProt ID | Q1RMW2 |
◆ Native Proteins | ||
MPOC-235H | Active Native Human Myeloperoxidase Isoform C | +Inquiry |
HPX-84R | Native Rat Hemopexin | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
ALPA-1184P | Native Porcine Alkaline Phosphatase Activity | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLCO1B3-1688HCL | Recombinant Human SLCO1B3 293 Cell Lysate | +Inquiry |
RBL1-2484HCL | Recombinant Human RBL1 293 Cell Lysate | +Inquiry |
LIN37-4732HCL | Recombinant Human LIN37 293 Cell Lysate | +Inquiry |
ATRIP-8567HCL | Recombinant Human ATRIP 293 Cell Lysate | +Inquiry |
SLC20A1-1797HCL | Recombinant Human SLC20A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM184A Products
Required fields are marked with *
My Review for All TMEM184A Products
Required fields are marked with *
0
Inquiry Basket