Recombinant Full Length Bovine Spermatid Maturation Protein 1(Spem1) Protein, His-Tagged
Cat.No. : | RFL6235BF |
Product Overview : | Recombinant Full Length Bovine Spermatid maturation protein 1(SPEM1) Protein (Q32LJ5) (1-313aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-313) |
Form : | Lyophilized powder |
AA Sequence : | MAMAERPRPGWASYHNPNTNSCQDLGNSILLLLGLIICINIGINMVTLLWRRLRGFLHQV FRVICEKEASKLRSPGKQTQPSKHSSPAVHLRCTMDAVKMTVTPPPTRRRHRRGSSSRRA RRPVAWAPDTDDDDDEKPPHQHTAACSHNWDYPEDWEGLQTAQRFWTPWAQDTLEPPTQT IRFQQTIEGRPLKREMQSDLGLEAYVYPVNPPLPSPQILSHKNSGGGAGAGAQAEQEQCA PAEPPILGPANVPDIPRRRSSGRVTYDARDVRRRLRELTREVEALSHCYPLASGSSTAEG TRKDWVYRSMTER |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPEM1 |
Synonyms | SPEM1; Spermatid maturation protein 1 |
UniProt ID | Q32LJ5 |
◆ Recombinant Proteins | ||
FDXACB1-5807M | Recombinant Mouse FDXACB1 Protein | +Inquiry |
Il4-646M | Recombinant Mouse Il4 protein, His & GST-tagged | +Inquiry |
DICP2.1-8219Z | Recombinant Zebrafish DICP2.1 | +Inquiry |
YWHAG-12H | Recombinant Human YWHAG | +Inquiry |
MTAP-29502TH | Recombinant Human MTAP, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Mucin-357 | Native Porcine Mucin protein | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
Histone-52C | Native Calf Histone | +Inquiry |
Thrombin-12S | Native Atlantic salmon Thrombin | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAJC5-497HCL | Recombinant Human DNAJC5 cell lysate | +Inquiry |
CST3-1938RCL | Recombinant Rat CST3 cell lysate | +Inquiry |
SIGLEC10-1849HCL | Recombinant Human SIGLEC10 293 Cell Lysate | +Inquiry |
CCNYL1-7699HCL | Recombinant Human CCNYL1 293 Cell Lysate | +Inquiry |
MB-4446HCL | Recombinant Human MB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPEM1 Products
Required fields are marked with *
My Review for All SPEM1 Products
Required fields are marked with *
0
Inquiry Basket