Recombinant Full Length Bovine Protein Lifeguard 1(Grina) Protein, His-Tagged
Cat.No. : | RFL15368BF |
Product Overview : | Recombinant Full Length Bovine Protein lifeguard 1(GRINA) Protein (Q32L53) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MSHEKSFLVSGDSYPPPNPGYPGGPQPSMAPYPGAPYPQAPFQPSPYGQPGYPQGPSPYP QGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQSPFPPNPYGQPQAFPAQDP GSPHHGNYHEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVAVFTF VGEVKGFVRENVWTYYVSYAIFFVSLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMI ASFYNTEAVIMAVGITTTVCFTVVIFSMQTRYDFTSCVGVLLVSVVVLILFAILCIFIRS RVLEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTI IGRAKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GRINA |
Synonyms | GRINA; LFG1; NMDARA1; Protein lifeguard 1; Glutamate [NMDA] receptor-associated protein 1; NMDA receptor glutamate-binding subunit |
UniProt ID | Q32L53 |
◆ Recombinant Proteins | ||
RFL3750RF | Recombinant Full Length Rat Protein Lifeguard 1(Grina) Protein, His-Tagged | +Inquiry |
GRINA-13537H | Recombinant Human GRINA, GST-tagged | +Inquiry |
GRINA-2360R | Recombinant Rat GRINA Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25972MF | Recombinant Full Length Mouse Protein Lifeguard 1(Grina) Protein, His-Tagged | +Inquiry |
GRINA-7276M | Recombinant Mouse GRINA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRINA-5743HCL | Recombinant Human GRINA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRINA Products
Required fields are marked with *
My Review for All GRINA Products
Required fields are marked with *
0
Inquiry Basket