Recombinant Full Length Bovine Protein Casc4(Casc4) Protein, His-Tagged
Cat.No. : | RFL12938BF |
Product Overview : | Recombinant Full Length Bovine Protein CASC4(CASC4) Protein (A2VE10) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MVGFGANRRAGRLPSLVLAVLLVVIAVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDSHKKQIDQKEADYGRLSSRLQAREGLGKRCEDDKVKLQNNISYQMADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQIKELRAQHEENIKKLADQFLQEQKQEAHKFESKGGNELDTDNHAVPKNIPEVAENGAGKNEEPSSHHIPHGKEQIKRGGDAGMPGIEENDLAKAEDVPVALKKPPVSFSQYESHQVISHLPTGQPLSPNMVPDSHINHNGNSRTSKQNPSNPLQRLIPGPNLENEPRIQAEVLKQATKDRAGDFHKLKQNDEERELQMDPADYGKQRFNDAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CASC4 |
Synonyms | GOLM2; CASC4; Protein GOLM2; Cancer susceptibility candidate gene 4 protein homolog; Golgi membrane protein 2 |
UniProt ID | A2VE10 |
◆ Recombinant Proteins | ||
CASC4-2270C | Recombinant Chicken CASC4 | +Inquiry |
CASC4-2904HF | Recombinant Full Length Human CASC4 Protein, GST-tagged | +Inquiry |
CASC4-1235M | Recombinant Mouse CASC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12938BF | Recombinant Full Length Bovine Protein Casc4(Casc4) Protein, His-Tagged | +Inquiry |
CASC4-0409H | Recombinant Human CASC4 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASC4-7843HCL | Recombinant Human CASC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CASC4 Products
Required fields are marked with *
My Review for All CASC4 Products
Required fields are marked with *
0
Inquiry Basket