Recombinant Full Length Bovine Probable Palmitoyltransferase Zdhhc16(Zdhhc16) Protein, His-Tagged
Cat.No. : | RFL676BF |
Product Overview : | Recombinant Full Length Bovine Probable palmitoyltransferase ZDHHC16(ZDHHC16) Protein (Q58CU4) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MRGQWSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA VDAAFEPIYWLVDNVIRWCGVVFVVLVIVLTSSIVAIAYLCVLPLILQTYSVPRLCWHFF YSHWNLILIVFHYYQAITTPPGYPPQGRNDMTTVSICKKCINPKPARTHHCSICNRCVLK MDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKL QAVANQTYHQTPPPTFSFRERVTHKSLVYLWFLCSSVALALGALTIWHAVLISRGETSIE RHINKKERQRLQAKGRVFRNHYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMS WDPPPWVTAHSASVMAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ZDHHC16 |
Synonyms | ZDHHC16; Palmitoyltransferase ZDHHC16; Zinc finger DHHC domain-containing protein 16; DHHC-16 |
UniProt ID | Q58CU4 |
◆ Recombinant Proteins | ||
MPXV-0840 | Recombinant Monkeypox Virus Protein, Putative ATPase | +Inquiry |
UBE2CBP-9821M | Recombinant Mouse UBE2CBP Protein, His (Fc)-Avi-tagged | +Inquiry |
GNE-2605R | Recombinant Rat GNE Protein | +Inquiry |
C9orf78-0213H | Recombinant Human C9orf78 Protein, GST-Tagged | +Inquiry |
ZFP458-18947M | Recombinant Mouse ZFP458 Protein | +Inquiry |
◆ Native Proteins | ||
CPB2-27270TH | Native Human CPB2 | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
CMV-06 | Native Cytomegalovirus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT1-8863HCL | Recombinant Human ANGPT1 293 Cell Lysate | +Inquiry |
PIP5K1A-3173HCL | Recombinant Human PIP5K1A 293 Cell Lysate | +Inquiry |
TOR1A-866HCL | Recombinant Human TOR1A 293 Cell Lysate | +Inquiry |
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
TUBGCP3-641HCL | Recombinant Human TUBGCP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ZDHHC16 Products
Required fields are marked with *
My Review for All ZDHHC16 Products
Required fields are marked with *
0
Inquiry Basket