Recombinant Full Length Bovine Mitochondrial Carrier Homolog 2(Mtch2) Protein, His-Tagged
Cat.No. : | RFL34848BF |
Product Overview : | Recombinant Full Length Bovine Mitochondrial carrier homolog 2(MTCH2) Protein (Q9N285) (2-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-303) |
Form : | Lyophilized powder |
AA Sequence : | ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLAPTVGRNIFGRQVCQLPGLFCYAQHI ASIDGKRGLFTGLTPRLCSGILGTVVHGKVLQHYQECDKAEESGSGNVQKEVSSSFDRVI KETTREMMARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIATIYREEGILGFFAG LIPRLLGDIISLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVS NLMAVNNCGLAGGCPPYAPIYSSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLRM LI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTCH2 |
Synonyms | MTCH2; Mitochondrial carrier homolog 2 |
UniProt ID | Q9N285 |
◆ Native Proteins | ||
PLAU-8456H | Active Native Human PLAU | +Inquiry |
ALB-7993H | Native Human Serum Albumin(20% Solution) | +Inquiry |
Hp-25 | Native Helicobacter pylori Antigen | +Inquiry |
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
Ferritin-180M | Native Mouse Ferritin | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRASP2-747HCL | Recombinant Human GPRASP2 cell lysate | +Inquiry |
BBS7-158HCL | Recombinant Human BBS7 cell lysate | +Inquiry |
SSBP2-1464HCL | Recombinant Human SSBP2 293 Cell Lysate | +Inquiry |
WHSC1L1-314HCL | Recombinant Human WHSC1L1 293 Cell Lysate | +Inquiry |
LRRC34-4634HCL | Recombinant Human LRRC34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTCH2 Products
Required fields are marked with *
My Review for All MTCH2 Products
Required fields are marked with *
0
Inquiry Basket