Recombinant Full Length Bovine Membrane Protein Fam159B(Fam159B) Protein, His-Tagged
Cat.No. : | RFL6686BF |
Product Overview : | Recombinant Full Length Bovine Membrane protein FAM159B(FAM159B) Protein (A6QQ93) (1-161aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-161) |
Form : | Lyophilized powder |
AA Sequence : | MSEASRVCSGYYSLNHSFVEPFQCPRRGEGATLLYCCGFADLKYCCSEPGSYFPYKHSYM WSLSIGALIGLGIAALVLLAFVISVCVLCYLFLYTKPQRLDTGLKLQHLEAVSTQEGNSN RKSKAPRSNAASNSTNETFYEADDIIQEKTMDTTQINTAYC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SHISAL2B |
Synonyms | SHISAL2B; FAM159B; Protein shisa-like-2B |
UniProt ID | A6QQ93 |
◆ Native Proteins | ||
FSH-1566P | Active Native Porcine Stimulating Hormone | +Inquiry |
Prothrombin-271B | Active Native Bovine Prothrombin Frag 1 | +Inquiry |
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
Collagen Type IV-08H | Native Human Collagen Type IV | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL6-4024HCL | Recombinant Human MYL6 293 Cell Lysate | +Inquiry |
MARS2-1061HCL | Recombinant Human MARS2 cell lysate | +Inquiry |
SF3A3-1919HCL | Recombinant Human SF3A3 293 Cell Lysate | +Inquiry |
NOL12-3769HCL | Recombinant Human NOL12 293 Cell Lysate | +Inquiry |
ADORA3-12HCL | Recombinant Human ADORA3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SHISAL2B Products
Required fields are marked with *
My Review for All SHISAL2B Products
Required fields are marked with *
0
Inquiry Basket