Recombinant Full Length Bovine Melanocortin Receptor 5(Mc5R) Protein, His-Tagged
Cat.No. : | RFL17994BF |
Product Overview : | Recombinant Full Length Bovine Melanocortin receptor 5(MC5R) Protein (P56451) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MNSSFHLHFLDLGLNTTDGNLSGLSVQNASSLCEDMGIAVEVFLALGLISLLENILVIGA IVRNRNLHTPMYFFVGSLAVADMLVSLSNSWETITIYLLTNKHLVMADASVRHLDNVFDS MICISVVASMCSLLAIAVDRYVTIFCALRYQRIMTGRRSGAIIGGIWAFCASCGTVFIVY YESTYVVICLIAMFLTMLLLMASLYTHMFLLARTHIRRIATLPGHSSVRQRTGVKGAITL AMLLGVFIVCWAPFFLHLILMISCPHNLYCSCFMSHFNMYLILIMCNSVIDPLIYAFRSQ EMRKTFKEIVCFQSFRTPCRFPSRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MC5R |
Synonyms | MC5R; Melanocortin receptor 5; MC5-R |
UniProt ID | P56451 |
◆ Recombinant Proteins | ||
MYT1-3005H | Recombinant Human MYT1 Protein, His-tagged | +Inquiry |
HS3ST1-3693HF | Recombinant Full Length Human HS3ST1 Protein, GST-tagged | +Inquiry |
CHRM1-685R | Recombinant Rhesus Macaque CHRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TGFB3-246H | Active Recombinant Human/Mouse TGFB3 Protein | +Inquiry |
SAT1-3471H | Recombinant Human SAT1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP11-27648TH | Native Human MMP11 | +Inquiry |
Complement C4b-51H | Native Human Complement C4b | +Inquiry |
CRP-8059R | Native Rat Serum C-Reactive Protein | +Inquiry |
F10-9H | Native Human Factor Xa, Active Site Labeled with Biotin | +Inquiry |
Protein C-89H | Native Human Protein C | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHBDL2-1503HCL | Recombinant Human RHBDL2 cell lysate | +Inquiry |
FERMT1-236HCL | Recombinant Human FERMT1 cell lysate | +Inquiry |
GPR183-5790HCL | Recombinant Human GPR183 293 Cell Lysate | +Inquiry |
ASB3-8665HCL | Recombinant Human ASB3 293 Cell Lysate | +Inquiry |
Skin-113M | Mouse Skin Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MC5R Products
Required fields are marked with *
My Review for All MC5R Products
Required fields are marked with *
0
Inquiry Basket