Recombinant Full Length Bovine Lysoplasmalogenase-Like Protein Tmem86A(Tmem86A) Protein, His-Tagged
Cat.No. : | RFL18914BF |
Product Overview : | Recombinant Full Length Bovine Lysoplasmalogenase-like protein TMEM86A(TMEM86A) Protein (Q3MHQ7) (1-240aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-240) |
Form : | Lyophilized powder |
AA Sequence : | MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCLWLFLLAHGLG FLLTHPSATRIFVGLVFSAIGDAFLIWQDQGYFVHGMLMFAVTHMLYASAFGMRPLGLRT GLLMVILSGLCYAFLYPNLTGAFTYVVGVYVAIIGFMGWRAMAGLQLVGAAWRWTELAAG TGALLFIVSDLTIALDKFCFPVPYSRALIMSTYYAAQMLIALSAVESREPVEDYRLSKAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TMEM86A |
Synonyms | TMEM86A; Lysoplasmalogenase-like protein TMEM86A; Transmembrane protein 86A |
UniProt ID | Q3MHQ7 |
◆ Recombinant Proteins | ||
DVL2-173H | Recombinant Human dishevelled segment polarity protein 2 Protein, Strep&Flag tagged | +Inquiry |
CACNA1S-0268H | Recombinant Human CACNA1S Protein, GST-Tagged | +Inquiry |
CT45A3-1215H | Recombinant Human CT45A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PRL3C1-7110M | Recombinant Mouse PRL3C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEF2A-2549R | Recombinant Rhesus Macaque MEF2A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
Angiostatin K1-4-22H | Native Human Angiostatin K1-4 Protein | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
S100BB-10H | Native Human S100BB | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR7A3-53HCL | Recombinant Human AKR7A3 cell lysate | +Inquiry |
CLEC10A-1730MCL | Recombinant Mouse CLEC10A cell lysate | +Inquiry |
MBD4-403HCL | Recombinant Human MBD4 lysate | +Inquiry |
C20orf111-8126HCL | Recombinant Human C20orf111 293 Cell Lysate | +Inquiry |
FAM228A-8060HCL | Recombinant Human C2orf84 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMEM86A Products
Required fields are marked with *
My Review for All TMEM86A Products
Required fields are marked with *
0
Inquiry Basket