Recombinant Full Length Bovine Insulin-Induced Gene 1 Protein(Insig1) Protein, His-Tagged
Cat.No. : | RFL14093BF |
Product Overview : | Recombinant Full Length Bovine Insulin-induced gene 1 protein(INSIG1) Protein (A0JNC3) (1-276aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-276) |
Form : | Lyophilized powder |
AA Sequence : | MPRLDDHLWRGPCAKGTKHRSHPRASARGLVAKAGEMINSSGSGPSLLAAHGALGTDPAH GPQSAGVGGQGSSSHVNSWHHHLVQRSLVLFSVGVVLALVLNLLQVQRNVTLFPDEVIAT IFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCVAVFVGINHASAKL DFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQLLVYNGVYQYTSPDF LYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | INSIG1 |
Synonyms | INSIG1; Insulin-induced gene 1 protein; INSIG-1 |
UniProt ID | A0JNC3 |
◆ Native Proteins | ||
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
CA 19-9-378H | Active Native Human Cancer Antigen 19-9 | +Inquiry |
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
PTA-23B | Active Native Bacillus stearothermophilus Phosphotransacetylase | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
◆ Cell & Tissue Lysates | ||
Brain-43R | Rabbit Brain Lysate | +Inquiry |
PLXDC1-1912HCL | Recombinant Human PLXDC1 cell lysate | +Inquiry |
CIR1-7492HCL | Recombinant Human CIR1 293 Cell Lysate | +Inquiry |
CCL27-302HCL | Recombinant Human CCL27 cell lysate | +Inquiry |
LOXL4-4676HCL | Recombinant Human LOXL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INSIG1 Products
Required fields are marked with *
My Review for All INSIG1 Products
Required fields are marked with *
0
Inquiry Basket