Recombinant Full Length Bovine Cytochrome P450 2U1(Cyp2U1) Protein, His-Tagged
Cat.No. : | RFL439BF |
Product Overview : | Recombinant Full Length Bovine Cytochrome P450 2U1(CYP2U1) Protein (Q0IIF9) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MASPGLPQPPTEDAAWPLRLLHAPPGLLRLDPTGGALLLLVLAALLGWSWLWRLPERGIP PGPAPWPVVGNFGFVLLPRFLRRKSWPYRRARNGGMNASGQGVQLLLADLGRVYGNIFSF LIGHYLVVVLNDFHSVREALVQQAEVFSDRPRVPLTSIMTKGKGIVFAHYGPVWRQQRKF SHSTLRHFGLGKLSLEPKIIEEFRYVKEEMQKHGDAPFNPFPIVNNAVSNIICSLCFGRR FDYTNSEFKQMLNFMSRALEVCLNTQLLLVNICSWLYYLPFGPFKELRQIEKDLTLFLKK IIKDHRESLDVENPQDFIDMYLLHVEEEKKNNSNSGFDEDYLFYIIGDLFIAGTDTTTNS LLWCLLYMSLHPNIQEKIHEEIARVIGADRAPSLTDKAQMPYTEATIMEVQRLSTVVPLS IPHMTSEKTVLQGFTIPKGTIILPNLWSVHRDPAIWEKPNDFYPDRFLDDQGQLIKKETF IPFGIGKRVCMGEQLAKMELFLMFVSLMQSFTFVLPKDSKPILTGKYGLTLAPHPFNIII SKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP2U1 |
Synonyms | CYP2U1; Cytochrome P450 2U1; Long-chain fatty acid omega-monooxygenase |
UniProt ID | Q0IIF9 |
◆ Recombinant Proteins | ||
RFL28800MF | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj1566(Mj1566) Protein, His-Tagged | +Inquiry |
KDR-8718RF | Recombinant Rat Kdr Protein, Fc-tagged, FITC conjugated | +Inquiry |
FAM110B-2956M | Recombinant Mouse FAM110B Protein, His (Fc)-Avi-tagged | +Inquiry |
AKIRIN2-525HFL | Recombinant Full Length Human AKIRIN2 Protein, C-Flag-tagged | +Inquiry |
TDRD7-5661R | Recombinant Rat TDRD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
C3-001C | Active Native C. botulinum C3 Enzyme | +Inquiry |
Complement C3b-47H | Native Human Complement C3b | +Inquiry |
Tnni2-7429M | Native Mouse Tnni2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAD2L2-4567HCL | Recombinant Human MAD2L2 293 Cell Lysate | +Inquiry |
STX5-1374HCL | Recombinant Human STX5 293 Cell Lysate | +Inquiry |
SNAPC5-1636HCL | Recombinant Human SNAPC5 293 Cell Lysate | +Inquiry |
MPHOSPH8-4237HCL | Recombinant Human MPHOSPH8 293 Cell Lysate | +Inquiry |
MGC70870-1107HCL | Recombinant Human MGC70870 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2U1 Products
Required fields are marked with *
My Review for All CYP2U1 Products
Required fields are marked with *
0
Inquiry Basket