Recombinant Full Length Bovine Cytochrome B561 Domain-Containing Protein 2(Cyb561D2) Protein, His-Tagged
Cat.No. : | RFL30878BF |
Product Overview : | Recombinant Full Length Bovine Cytochrome b561 domain-containing protein 2(CYB561D2) Protein (Q5E965) (2-222aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-222) |
Form : | Lyophilized powder |
AA Sequence : | ALSVETESHIYRALRTVSGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMT EALLVFSPESSLLRSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLATWHG RAGLLAVLWAGLQCSGGVGLLYPKLLPRWPLAKLKLYHATSGLVGYLLGGASLLLGMCSL WFTATVTGGVWYLAVLCPVITSLVIMNQVSNAYLYRKRIQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYB561D2 |
Synonyms | CYB561D2; Transmembrane reductase CYB561D2; Cytochrome b561 domain-containing protein 2 |
UniProt ID | Q5E965 |
◆ Native Proteins | ||
C7-56H | Native Human Complement C7 | +Inquiry |
SERPINA3-8008H | Native Human Serum Alpha 1-AntiChymoTrypsin | +Inquiry |
SERPINF2-27145TH | Native Human SERPINF2 | +Inquiry |
PerCP-139 | Native Dinophyceae sp. Peridinin-chlorophyll-protein complex protein | +Inquiry |
Cp-048R | Native Rat Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMD14-2751HCL | Recombinant Human PSMD14 293 Cell Lysate | +Inquiry |
SESN3-1586HCL | Recombinant Human SESN3 cell lysate | +Inquiry |
GPNMB-1886HCL | Recombinant Human GPNMB cell lysate | +Inquiry |
IFNA2-1634MCL | Recombinant Mouse IFNA2 cell lysate | +Inquiry |
MIF4GD-4315HCL | Recombinant Human MIF4GD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYB561D2 Products
Required fields are marked with *
My Review for All CYB561D2 Products
Required fields are marked with *
0
Inquiry Basket