Recombinant Full Length Bovine Chemokine-Like Receptor 1(Cmlkr1) Protein, His-Tagged
Cat.No. : | RFL24338BF |
Product Overview : | Recombinant Full Length Bovine Chemokine-like receptor 1(CMLKR1) Protein (B9VR26) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MEAEDYNASYEDYPDDVDPIVVLEELSPLEGRVVRILLVAVYSVICLLGILGNGLVIVMI TCKMKRTVNTVWFLNLAVADFLFNVFLPVHIAYAALDYHWVFGTAMCKISNFLLIHNMFT SVFLLTVISFDRCVSVLLPVWSQNHRSVRLAYTACLVIWVLAFFLSSPSLVFRDTARLHG KISCFNNFSLSAAVSSPWPAHPQVDPVGSGRHKVVTITRFLCGFLVPGLITTACYLTIVY KLQRSRLAKTKKPFKIILTIIVTFFLCWCPYHAFYLLELRRGSVPPSVFSLGVPLATAIA IANSCMNPILYVFMGQDFKKFRVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERETG ML |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CMLKR1 |
Synonyms | CMLKR1; Chemerin-like receptor 1; Chemokine-like receptor 1; CMKLR-1 |
UniProt ID | B9VR26 |
◆ Recombinant Proteins | ||
GUK1-1841R | Recombinant Rhesus Macaque GUK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KMT2D-129H | Recombinant Human KMT2D Complex, His-tagged | +Inquiry |
EndoS2-01S | Recombinant Streptococcus pyogenes EndoS2 Protein | +Inquiry |
TNNC2-4880R | Recombinant Rhesus monkey TNNC2 Protein, His-tagged | +Inquiry |
CD274-010HA | Recombinant Human CD274 protein, mutant HIgG1 Fc-tagged, APC labeled | +Inquiry |
◆ Native Proteins | ||
IgG-004B | Native Bovine Whole Molecule IgG, Biotin-LC-NHS Conjugated | +Inquiry |
VZV-05 | Native Varicella Zoster Virus (VZV) Glycoprotein Antigen | +Inquiry |
IgG-339H | Native Horse IgG | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL5-7180HCL | Recombinant Human CUL5 293 Cell Lysate | +Inquiry |
ARF1-8760HCL | Recombinant Human ARF1 293 Cell Lysate | +Inquiry |
DDIT3-7027HCL | Recombinant Human DDIT3 293 Cell Lysate | +Inquiry |
FLAD1-6197HCL | Recombinant Human FLAD1 293 Cell Lysate | +Inquiry |
TIMP2-2061HCL | Recombinant Human TIMP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMLKR1 Products
Required fields are marked with *
My Review for All CMLKR1 Products
Required fields are marked with *
0
Inquiry Basket