Recombinant Full Length Bovine Carnitine O-Palmitoyltransferase 1, Muscle Isoform(Cpt1B) Protein, His-Tagged
Cat.No. : | RFL25583BF |
Product Overview : | Recombinant Full Length Bovine Carnitine O-palmitoyltransferase 1, muscle isoform(CPT1B) Protein (Q58DK1) (1-771aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-771) |
Form : | Lyophilized powder |
AA Sequence : | MAEAHQAVAFQFTVTPEGVDFQLSREVLKHIYLSVIRSWKKRLIRIKNGILRGVYPGSPT SWLVVVMATAGSSYYNVDISMGLVYYIQRWLPEGRPYRTPYTRTLFSMAIFSTGVWMMGI FFFRQTLKLLLSYHGWMFELHGQTSHLTRVWAVCVRLLSGRRPMLYSFQTSLPKLPVPSV PATVHRYLESVEHLLDDEQYYRMETLAKEFEEKTAPRLQKYLVLKSWWATNYVSDWWEEY VYLRGRNPIVVNSNYYVMDLVLVKNTDVQAARLGNAVHAMITYRRKLDREEIKPVMALGL VPMCSYQMERMFNTTRIPGKDTDVLQHLPDSRHVAVYHKGRFFKVWLYEGSRLLKPRDLE MQFQRILDDPSPPQPGEERLAALTAGGRVEWAQARQAFFSSGKNKAALDAIERAAFFVAL DEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNTEHAWADAPII GHLWEFVLGTDSFHLGYTETGHCLGKPNPVLPPPQRLQWDIPKQCQAVIESSYQVAKALA DDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREGR TETVRSCTRESTAFVQAMVQGRHLNEDLQRLFRKAAEKHQNMYRLAMTGAGIDRHLFCLY VVSKYLGVESPFLAEVLSEPWRLSTSQIAQFQIRMFDPNKYPKHLGAGGGFGPVADDGYG VSYMIAGENTIFFHVSSKFSSSETNAQRFGNQIRQALLDIANLFQVPKADG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CPT1B |
Synonyms | CPT1B; Carnitine O-palmitoyltransferase 1, muscle isoform; CPT1-M; Carnitine O-palmitoyltransferase I, muscle isoform; CPT I; CPTI-M; Carnitine palmitoyltransferase 1B |
UniProt ID | Q58DK1 |
◆ Recombinant Proteins | ||
GP1BB-15H | Active Recombinant Human GP1BB Protein (26-147aa), C-His-tagged | +Inquiry |
RETN-1351C | Recombinant Cattle RETN Protein, His-tagged | +Inquiry |
OPRP-1883P | Recombinant Pseudomonas Aeruginosa OPRP Protein (30-440 aa), His-SUMO-tagged | +Inquiry |
RBP2A-9454Z | Recombinant Zebrafish RBP2A | +Inquiry |
ZBED1-5063R | Recombinant Rhesus Macaque ZBED1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
AMY1A-5313H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZBTB33-1954HCL | Recombinant Human ZBTB33 cell lysate | +Inquiry |
GRINA-5743HCL | Recombinant Human GRINA 293 Cell Lysate | +Inquiry |
SCGB2A2-2036HCL | Recombinant Human SCGB2A2 293 Cell Lysate | +Inquiry |
C14orf126-8289HCL | Recombinant Human C14orf126 293 Cell Lysate | +Inquiry |
NAT9-3959HCL | Recombinant Human NAT9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPT1B Products
Required fields are marked with *
My Review for All CPT1B Products
Required fields are marked with *
0
Inquiry Basket