Recombinant Full Length Botryotinia Fuckeliana Altered Inheritance Of Mitochondria Protein 31, Mitochondrial(Aim31) Protein, His-Tagged
Cat.No. : | RFL27981BF |
Product Overview : | Recombinant Full Length Botryotinia fuckeliana Altered inheritance of mitochondria protein 31, mitochondrial(aim31) Protein (A6SSX6) (1-175aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Botryotinia fuckeliana |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-175) |
Form : | Lyophilized powder |
AA Sequence : | MSNSTPLPSSFDGDTDFYEENRWQKLTRRLKEEPLIPLGCILTSLALVGASRSIRAGDHN RTQRMFRARIYAQGFTLLAMVAGSMYWDSDRKKRKEFEGVLAETKAKEKNEAWIRELEAR DEEEKEMRRARDERRRRAEGRPAPKAVVTDAPAEEGEKPKGGVMEQMSGLVWGKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rcf1 |
Synonyms | rcf1; aim31; BC1G_15810; Respiratory supercomplex factor 1, mitochondrial |
UniProt ID | A6SSX6 |
◆ Recombinant Proteins | ||
SLMO1-8450M | Recombinant Mouse SLMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TNFSF9-131H | Recombinant Human TNFSF9, His-tagged | +Inquiry |
gH-3847H | Recombinant Human cytomegalovirus gH protein, His-SUMO-tagged | +Inquiry |
PPAT-5263Z | Recombinant Zebrafish PPAT | +Inquiry |
KCNH1B-8314Z | Recombinant Zebrafish KCNH1B | +Inquiry |
◆ Native Proteins | ||
THBS1-31515TH | Native Human THBS1 | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
Thromboplastin-078R | Native Rabbit Thromboplastin Protein | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
IgG-012L | Native Llama Ig fraction | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRB-1112RCL | Recombinant Rat PDGFRB cell lysate | +Inquiry |
GORASP2-5828HCL | Recombinant Human GORASP2 293 Cell Lysate | +Inquiry |
C11orf1-8356HCL | Recombinant Human C11orf1 293 Cell Lysate | +Inquiry |
PAK1-1275HCL | Recombinant Human PAK1 cell lysate | +Inquiry |
SENP7-1972HCL | Recombinant Human SENP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rcf1 Products
Required fields are marked with *
My Review for All rcf1 Products
Required fields are marked with *
0
Inquiry Basket