Recombinant Full Length Borrelia Burgdorferi Uncharacterized Protein Bb_0381 (Bb_0381) Protein, His-Tagged
Cat.No. : | RFL17666BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Uncharacterized protein BB_0381 (BB_0381) Protein (P94250) (1-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-474) |
Form : | Lyophilized powder |
AA Sequence : | MNKKMFPKIYYYDQDFIDIYNKSLSWIQDKVILQKVADRGKKDKNYYSENCDYIDQMQAC MSSFFLVYSNGEYSSTSAIDKFYQLQEESGAIRARYDNNNAIIDLDENEENIGFPIFAWA EYNLYHKTGNKKRISEVLPILDKYYKWIESKFLKENGLYSIDVNKIFYKNSPRVDAYYPI DFNSLQVHNAYCISKLADILNDKNLSLEYKKRFFSLKVKINSLMWSEKDGFYYDLDVNEN ILEIKTIVGFFPMLSEIPSEDRIERMIFYLKSTNHFGTPNPFPTLSVSEPGFSEDGNGYY GSVYTYMNFFVIKGLEYCGRANIAREFTIRHLYYILDTLMPFNKIKGHIWEAYRPMQEGP AYFDSNKKTYTEKGLICYLALFSISLMIENIIGLTISLPDKTVYWNIPTLEIMGIESLSL KKNQTTIICNKGKRGWEIKMESEKLYYFTINILNKKEKTLPIPSGRCSMLLDKL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BB_0381 |
Synonyms | BB_0381; Uncharacterized protein BB_0381 |
UniProt ID | P94250 |
◆ Recombinant Proteins | ||
TRIM68-3417H | Recombinant Human TRIM68, His-tagged | +Inquiry |
TBC1D10A-16476M | Recombinant Mouse TBC1D10A Protein | +Inquiry |
EIF5A-2726M | Recombinant Mouse EIF5A Protein, His (Fc)-Avi-tagged | +Inquiry |
GJB6-3576M | Recombinant Mouse GJB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD47-556H | Recombinant Human CD47 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
LOX1.1-61S | Native soybeans LOX1.1 Protein | +Inquiry |
PGC-8318H | Native Human PGC | +Inquiry |
F13A1-28806TH | Native Human F13A1 | +Inquiry |
ALPI-8341C | Native Calf ALPI | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
◆ Cell & Tissue Lysates | ||
C17orf62-8234HCL | Recombinant Human C17orf62 293 Cell Lysate | +Inquiry |
SMU1-1649HCL | Recombinant Human SMU1 293 Cell Lysate | +Inquiry |
KRTAP20-2-4845HCL | Recombinant Human KRTAP20 293 Cell Lysate | +Inquiry |
TRAF3-823HCL | Recombinant Human TRAF3 293 Cell Lysate | +Inquiry |
TAP2-1736HCL | Recombinant Human TAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BB_0381 Products
Required fields are marked with *
My Review for All BB_0381 Products
Required fields are marked with *
0
Inquiry Basket