Recombinant Full Length Bombina Orientalis [Phe13]-Bombesin Receptor(Bb4) Protein, His-Tagged
Cat.No. : | RFL36994BF |
Product Overview : | Recombinant Full Length Bombina orientalis [Phe13]-bombesin receptor(BB4) Protein (P47751) (1-392aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bombina orientalis (Oriental fire-bellied toad) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-392) |
Form : | Lyophilized powder |
AA Sequence : | MPEGFQSLNQTLPSAISSIAHLESLNDSFILGAKQSEDVSPGLEILALISVTYAVIISVG ILGNTILIKVFFKIKSMQTVPNIFITSLAFGDLLLLLTCVPVDASRYIVDTWMFGRAGCK IISFIQLTSVGVSVFTLTVLSADRYRAIVKPLQLQTSDAVLKTCGKAVCVWIISMLLAAP EAVFSDLYEFGSSEKNTTFEACAPYPVSEKILQETHSLICFLVFYIVPLSIISAYYFLIA KTLYKSTFNMPAEEHTHARKQIESRKRVAKTVLVLVALFAVCWLPNHMLYLYRSFTYHSA VNSSAFHLSATIFARVLAFSNSCVNPFALYWLSRSFRQHFKKQVYCCKTEPPASQQSPTH SSTITGITAVKGNIQMSEISITLLSAYDVKKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BB4 |
Synonyms | BB4; [Phe13]-bombesin receptor; Bombesin receptor subtype-4; BRS-4 |
UniProt ID | P47751 |
◆ Native Proteins | ||
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
VIM-186B | Native bovine VIM | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GREM1-001MCL | Recombinant Mouse GREM1 cell lysate | +Inquiry |
PENK-3298HCL | Recombinant Human PENK 293 Cell Lysate | +Inquiry |
CDC5L-7648HCL | Recombinant Human CDC5L 293 Cell Lysate | +Inquiry |
RDH14-2436HCL | Recombinant Human RDH14 293 Cell Lysate | +Inquiry |
IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BB4 Products
Required fields are marked with *
My Review for All BB4 Products
Required fields are marked with *
0
Inquiry Basket