Recombinant Full Length Bifidobacterium Longum Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL28459BF |
Product Overview : | Recombinant Full Length Bifidobacterium longum Undecaprenyl-diphosphatase(uppP) Protein (Q8G6C4) (1-294aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bifidobacterium longum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-294) |
Form : | Lyophilized powder |
AA Sequence : | MNFFQAIILGIVQALTEYLPVSSSAHIRIFGDLMLGSDPGAAFTAIIQIGTELAVILYFR HDIINILTHWFSCLFGKNGKDWKARMGRGDNYATLGWNIIVGSIPIIILGFTLQNVIETS LRNLWITVTVLLVFGILLWMVDAKARQNKTMNDMTYRDAFLFGLGQSMALIPGVSRSGGT ITVGRALGYTREAAVRLSFLMAIPAVFGSGLLEAIKAVKNYKTDAMFPGWGPTLVAMVIS FVLGYIVIIGFLKFVSNFSYKAFAIYRIGLAVVVALLLIVGVLPAIDPSVVAAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; bacA; upk; BL0721; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q8G6C4 |
◆ Recombinant Proteins | ||
RGS2-772Z | Recombinant Zebrafish RGS2 | +Inquiry |
RFL31818AF | Recombinant Full Length Acidovorax Sp. Upf0391 Membrane Protein Ajs_0703 (Ajs_0703) Protein, His-Tagged | +Inquiry |
STX18-5469R | Recombinant Rat STX18 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gng12-1033M | Recombinant Mouse Gng12 Protein, MYC/DDK-tagged | +Inquiry |
CD96-3887H | Active Recombinant Human CD96 protein(Met1-Met503), His-tagged | +Inquiry |
◆ Native Proteins | ||
Thyroid-018H | Human Thyroid Lysate, Total Protein | +Inquiry |
IGHA1-210H | Native Human Immunoglobulin A1 (IgA1) | +Inquiry |
GFAP-18P | Native Porcine GFAP Protein | +Inquiry |
F5-5300H | Native Human Coagulation Factor V (proaccelerin, labile factor) | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX16-3290HCL | Recombinant Human PEX16 293 Cell Lysate | +Inquiry |
GPM6A-5803HCL | Recombinant Human GPM6A 293 Cell Lysate | +Inquiry |
SH3BP2-1871HCL | Recombinant Human SH3BP2 293 Cell Lysate | +Inquiry |
PDE6D-3345HCL | Recombinant Human PDE6D 293 Cell Lysate | +Inquiry |
Pancreas-436S | Sheep Pancreas Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket