Recombinant Full Length Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva Protein, His-Tagged
Cat.No. : | RFL291BF |
Product Overview : | Recombinant Full Length Beta-(1-->2)glucan export ATP-binding/permease protein NdvA Protein (P70864) (1-595aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella bacilliformis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-595) |
Form : | Lyophilized powder |
AA Sequence : | MSLFRTYVRVLSYLNQEKNAFLLICTANITLAIITIAEPILFGHVIDTIADKSDTLVTLA VWMCFGISNIIAYVLVARGADRLAHRCRLTVLEKSFARIISMPLIWHQQRGTSHALHTLL RATDSMSSIWLEFMRQHLSTFVALFVLVPVTFKMNWRLSIVLMVLAILYILIARLVMQKT KNGQAAVEHYHHNLFKHITDSISNVSIVQSYNRITEETSALHQHTNNLLSAQTPVLNWWA LASGLNRMASTISIVCVLLLGAFFVIKGQLSVGEVVTFVGFSQLMIGRLDQISGFINLAV SSQAKLQEFFDMEDSTFQTNEPANLPSLPNVKGAIQFHHVTYEFPNSSQGVFDISFEVKA GQTVAIVGPTGAGKTTLINLLQRVYDPTVGYISIDGININSINRESLRKALATVFQDAGL FDRTIRDNISIGKTGATDEELYEATKTASAHDFILKKSKNYDTLVGERGSQLSGGERQRL AIARAILKNAPILILDEATSALDVETEIRVKNAIDCISQNRTTFIIAHRLSTIRNADLVL FLDQGRLIEKGSFQELINKDGHFYKLLKRGGLTINQPATKEKDDNIIPLRKAMAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | P70864 |
◆ Recombinant Proteins | ||
CDC42BPB-2501H | Recombinant Human CDC42BPB protein(Met1-His427), His&GST-tagged | +Inquiry |
IFNA21-1424H | Recombinant Human IFNA21 Protein (24-189 aa), His-tagged | +Inquiry |
BMP6-656R | Recombinant Rat BMP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL33-448H | Recombinant Human Interleukin 33, His-tagged | +Inquiry |
SNCA-76H | Recombinant Human SNCA, A30P Mutant | +Inquiry |
◆ Native Proteins | ||
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
Ighg2a-161M | Native Mouse Immunoglobulin G2a | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
CP-8075R | Native Rat Serum Ceruloplasmin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPX-1472HCL | Recombinant Human SRPX 293 Cell Lysate | +Inquiry |
MINPP1-4312HCL | Recombinant Human MINPP1 293 Cell Lysate | +Inquiry |
FAIM2-6465HCL | Recombinant Human FAIM2 293 Cell Lysate | +Inquiry |
DDT-7022HCL | Recombinant Human DDT 293 Cell Lysate | +Inquiry |
TOMM34-870HCL | Recombinant Human TOMM34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket