Recombinant Full Length Bartonella Bacilliformis Atp Synthase Subunit B/B'(Atpg) Protein, His-Tagged
Cat.No. : | RFL95BF |
Product Overview : | Recombinant Full Length Bartonella bacilliformis ATP synthase subunit b/b'(atpG) Protein (A1URU4) (1-188aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella bacilliformis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-188) |
Form : | Lyophilized powder |
AA Sequence : | MLVSNVYAQTSEALRERVENALEHADRVFPPFDFSHFCSHFFWLVISFGFFYFFIARVIV PRIGCTIEIRRDRIASDLDRAMRLKQEADTVVEIYERKLAEARLQAYAIAQKTSNEIKEK TKLERKEIETSLDKKLADAEGQIAKIRNKAVQNIGSIAEEVVPEIVKKLIGVEVSKESVS LAVKAADN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | atpF2 |
Synonyms | atpF2; atpG; BARBAKC583_0378; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2 |
UniProt ID | A1URU4 |
◆ Native Proteins | ||
GG-193R | Native Rat Gamma Globulin protein | +Inquiry |
C3b-08H | Native Human Complement C3 beta protein | +Inquiry |
ALB-5362B | Native Bovine Albumin | +Inquiry |
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
Casein-01B | Active Native Bovine Casein Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD300LG-1061HCL | Recombinant Human CD300LG cell lysate | +Inquiry |
H2AFB3-314HCL | Recombinant Human H2AFB3 lysate | +Inquiry |
FGF22-6242HCL | Recombinant Human FGF22 293 Cell Lysate | +Inquiry |
USF1-479HCL | Recombinant Human USF1 293 Cell Lysate | +Inquiry |
EIF2C3-6666HCL | Recombinant Human EIF2C3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All atpF2 Products
Required fields are marked with *
My Review for All atpF2 Products
Required fields are marked with *
0
Inquiry Basket