Recombinant Mouse Tead4 protein, His&Myc-tagged
Cat.No. : | Tead4-4586M |
Product Overview : | Recombinant Mouse Tead4 protein(Q62296)(210-427aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 210-427aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.0 kDa |
AA Sequence : | RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Tead4 TEA domain family member 4 [ Mus musculus ] |
Official Symbol | Tead4 |
Synonyms | TEAD4; TEA domain family member 4; transcriptional enhancer factor TEF-3; RTEF-1; FGF-regulated 19; ETF-related factor 2; ETF-related factor-2; TEF-1-related factor 1; TEF-1-related factor FR-19; Tef3; Tefr; Etfr2; FR-19; TEF-3; Tefr1; ETFR-2; TEAD-4; Tefr1a; Tcf13r1; |
Gene ID | 21679 |
mRNA Refseq | NM_001080979 |
Protein Refseq | NP_001074448 |
◆ Recombinant Proteins | ||
TEAD4-1098C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-1100C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-1102C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-6335C | Recombinant Chicken TEAD4 | +Inquiry |
Tead4-4587M | Recombinant Mouse Tead4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tead4 Products
Required fields are marked with *
My Review for All Tead4 Products
Required fields are marked with *
0
Inquiry Basket